Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1) Recombinant Protein | EIF2AK1 recombinant protein

Recombinant Rabbit Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1); Recombinant Rabbit Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1); partial; EIF2AK1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
165-626. C-terminal fragment; contains Protein kinase domain
Sequence
RYLNEFEELSILGKGGYGRVYKVRNKLDGQYYAIKKILIKGATKTDCMKVLREVKVLAGLQHPNIVGYHTAWIEHVHVHVQADRVPIQLPSLEVLSDQEEDRDQYGVKNDASSSSSIIFAEFSPEKEKSSDECAV ESQNNKLVNYTTNLVVRDTGEFESSTERQENGSIVERQLLFGHNSDVEEDFTSAEESSEEDLSALRHTEVQYHLMLHIQMQLCELSLWDWIAERNRRSRECVDESACPYVMVSVATKIFQELVEGVFYIHNMGIVHRDLKPRNIFLHGPDQQVKIGDFGLACADIIQKNAARTSRNGERAPTHTSRVGTCLYASPEQLEGSEYDAKSDMYSVGVILLELFQPFGTEMERAEVLTGVRAGRIPDSLSKRCPAQAKYVQLLTRRNASQRPSALQLLQSELFQNSAHVNLTLQMKIIEQEREIEELKKQLSLLSQARGVRSDRRDGELPA
Sequence Length
626
Species
Rabbit
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for EIF2AK1 recombinant protein
This protein acts at the level of translation initiation to downregulate protein synthesis in response to stress. The encoded protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,274 Da
NCBI Official Full Name
eukaryotic translation initiation factor 2-alpha kinase 1
NCBI Official Symbol
EIF2AK1
NCBI Protein Information
eukaryotic translation initiation factor 2-alpha kinase 1
UniProt Protein Name
Eukaryotic translation initiation factor 2-alpha kinase 1
UniProt Gene Name
EIF2AK1
UniProt Synonym Gene Names
HRI; HCR

Uniprot Description

Inhibits protein synthesis at the translation initiation level, in response to various stress conditions, including oxidative stress, heme deficiency, osmotic shock and heat shock. Exerts its function through the phosphorylation of EIF2S1 at 'Ser-48' and 'Ser-51', thus preventing its recycling. Binds hemin forming a 1:1 complex through a cysteine thiolate and histidine nitrogenous coordination. This binding occurs with moderate affinity, allowing it to sense the heme concentration within the cell. Thanks to this unique heme-sensing capacity, plays a crucial role to shut off protein synthesis during acute heme-deficient conditions. In red blood cells (RBCs), controls hemoglobin synthesis ensuring a coordinated regulation of the synthesis of its heme and globin moieties. Thus plays an essential protective role for RBC survival in anemias of iron deficiency. Similarly, in hepatocytes, involved in heme-mediated translational control of CYP2B and CYP3A and possibly other hepatic P450 cytochromes (). May also contain ER stress during acute heme-deficient conditions ().

Research Articles on EIF2AK1

Similar Products

Product Notes

The EIF2AK1 eif2ak1 (Catalog #AAA948326) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 165-626. C-terminal fragment; contains Protein kinase domain. The amino acid sequence is listed below: RYLNEFEELS ILGKGGYGRV YKVRNKLDGQ YYAIKKILIK GATKTDCMKV LREVKVLAGL QHPNIVGYHT AWIEHVHVHV QADRVPIQLP SLEVLSDQEE DRDQYGVKND ASSSSSIIFA EFSPEKEKSS DECAV ESQ NNKLVNYTTN LVVRDTGEFE SSTERQENGS IVERQLLFGH NSDVEEDFTS AEESSEEDLS ALRHTEVQYH LMLHIQMQLC ELSLWDWIAE RNRRSRECVD ESACPYVMVS VATKIFQELV EGVFYIHNMG IVHRDLKPRN IFLHGPDQQV KIGDFGLACA DIIQKNAART SRNGERAPTH TSRVGTCLYA SPEQLEGSEY DAKSDMYSVG VILLELFQPF GTEMERAEVL TGVRAGRIPD SLSKRCPAQA KYVQLLTRRN ASQRPSALQL LQSELFQNSA HVNLTLQMKI IEQEREIEEL KKQLSLLSQA RGVRSDRRDG ELPA . It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.