LRR receptor-like serine/threonine-protein kinase EFR (EFR) Recombinant Protein | EFR recombinant protein
Recombinant Arabidopsis thaliana LRR receptor-like serine/threonine-protein kinase EFR (EFR) , partial
Gene Names
EFR; EF-TU receptor; F7C8.70; F7C8_70
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
LRR receptor-like serine/threonine-protein kinase EFR (EFR); Recombinant Arabidopsis thaliana LRR receptor-like serine/threonine-protein kinase EFR (EFR); partial; EFR recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
675-1031. Partial, provide the complete Cytoplasmic Domain
Sequence
KRKKKNNASDGNPSDSTTLGMFHEKVSYEELHSATSRFSSTNLIGSGNFGNVFKGLLGPENKLVAVKVLNLLKHGATKSFMAECETFKGIRHRNLVKLITVCSSLDSEGNDFRALVYEFMPKGSLDMWLQLEDLERVNDHSRSLTPAEKLNIAIDVASALEYLHVHCHDPVAHCDIKPSNILLDDDLTAHVSDFGLAQLLYKYDRESFLNQFSSAGVRGTIGYAAPEYGMGGQPSIQGDVYSFGILLLEMFSGKKPTDESFAGDYNLHSYTKSILSGCTSSGGSNAIDEGLRLVLQVGIKCSEEYPRDRMRTDEAVRELISIRSKFFSSKTTITESPRDAPQSSPQEWMLNTDMHTM
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
113,353 Da
NCBI Official Full Name
EF-TU receptor
NCBI Official Symbol
EFR
NCBI Official Synonym Symbols
EF-TU receptor; F7C8.70; F7C8_70
NCBI Protein Information
EF-TU receptor
UniProt Protein Name
LRR receptor-like serine/threonine-protein kinase EFR
Protein Family
UniProt Gene Name
EFR
UniProt Synonym Gene Names
EF-Tu receptor
NCBI Description
Encodes a predicted leucine-rich repeat receptor kinase (LRR-RLK). Functions as the receptor for bacterial PAMP (pathogen associated molecular patterns) EF-Tu.
Uniprot Description
Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Reduces transformation by Rhizobium radiobacter probably by inducing plant defense during the interaction. Binding to the effector AvrPto1 from P.syringae blocks the downstream plant immune response while interaction with hopD2 decreases the phosphorylation level of EFR upon elf18 treatment. Specific endoplasmic reticulum quality control components (ERD2B, CRT3, UGGT and STT3A) are required for the biogenesis of EFR.
Research Articles on EFR
Similar Products
Product Notes
The EFR efr (Catalog #AAA1057071) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 675-1031. Partial, provide the complete Cytoplasmic Domain. The amino acid sequence is listed below: KRKKKNNASD GNPSDSTTLG MFHEKVSYEE LHSATSRFSS TNLIGSGNFG NVFKGLLGPE NKLVAVKVLN LLKHGATKSF MAECETFKGI RHRNLVKLIT VCSSLDSEGN DFRALVYEFM PKGSLDMWLQ LEDLERVNDH SRSLTPAEKL NIAIDVASAL EYLHVHCHDP VAHCDIKPSN ILLDDDLTAH VSDFGLAQLL YKYDRESFLN QFSSAGVRGT IGYAAPEYGM GGQPSIQGDV YSFGILLLEM FSGKKPTDES FAGDYNLHSY TKSILSGCTS SGGSNAIDEG LRLVLQVGIK CSEEYPRDRM RTDEAVRELI SIRSKFFSSK TTITESPRDA PQSSPQEWML NTDMHTM . It is sometimes possible for the material contained within the vial of "LRR receptor-like serine/threonine-protein kinase EFR (EFR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
