EF-hand domain-containing protein D1 (EFHD1) Recombinant Protein | EFHD1 recombinant protein

Recombinant Human EF-hand domain-containing protein D1 (EFHD1)

Cat. Num. AAA1410699

• Gene Names: EFHD1; SWS2; MST133; PP3051; MSTP133
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: EF-hand domain-containing protein D1 (EFHD1); Recombinant Human EF-hand domain-containing protein D1 (EFHD1); EFHD1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-239, Full length protein
• Sequence: MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLSRRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT
• Sequence Length: 239

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 343098481
• NCBI GeneID: 80303
• NCBI Accession #: NP_001230181.1
• NCBI GenBank Nucleotide #: NM_001243252.1
• UniProt Accession #: Q9BUP0; Q9BTF8; Q9H8I2; Q9HBQ0; B2RD83; E9PFH3
• Molecular Weight: 16,145 Da
• NCBI Official Full Name: EF-hand domain-containing protein D1 isoform 2
• NCBI Official Synonym Full Names: EF-hand domain family member D1
• NCBI Official Symbol: EFHD1
• NCBI Official Synonym Symbols: SWS2; MST133; PP3051; MSTP133
• NCBI Protein Information: EF-hand domain-containing protein D1
• UniProt Protein Name: EF-hand domain-containing protein D1
• Protein Family: EF-hand domain-containing protein
• UniProt Gene Name: EFHD1
• UniProt Synonym Gene Names: SWS2

NCBI Description

This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is composed of an N-terminal disordered region, proline-rich elements, two EF-hands, and a C-terminal coiled-coil domain. This protein has been shown to associate with the mitochondrial inner membrane, and in HeLa cells, acts as a novel mitochondrial calcium ion sensor for mitochondrial flash activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]

Uniprot Description

Acts as a calcium sensor for mitochondrial flash (mitoflash) activation, an event characterized by stochastic bursts of superoxide production (PubMed:26975899). May play a role in neuronal differentiation ().