Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Putative inactive ferrous iron permease EfeU (efeU) Recombinant Protein | efeU recombinant protein

Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU (efeU)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative inactive ferrous iron permease EfeU (efeU); Recombinant Escherichia coli Putative inactive ferrous iron permease EfeU (efeU); Recombinant Putative inactive ferrous iron permease EfeU (efeU); Putative inactive ferrous iron permease EfeU; Putative Fe(2+) ion permease EfeU; efeU recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-276
Sequence
MFVPFLIMLREGLEAALIVSLIASYLKRTQRGMXDCVMWIGVLLAAALCLGLGIFINETTGEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALVMMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQEAPSVSEVAVWFIYLIPALVAFALPPRAGATASRSA
Sequence Length
276
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
30,292 Da
NCBI Official Full Name
Putative inactive ferrous iron permease EfeU
UniProt Protein Name
Putative inactive ferrous iron permease EfeU
UniProt Gene Name
efeU
UniProt Synonym Gene Names
ycdN
UniProt Entry Name
EFEU_ECOLI

Uniprot Description

Subunit structure: Part of a ferrous iron transporter composed of EfeU, EfeO and EfeB. However, this EfeUOB tripartite iron transporter is defective in E.coli strain K12 due to a frameshift mutation in EfeU. Ref.4

Subcellular location: Cell inner membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the oxidase-dependent Fe transporter (OFeT) (TC 9.A.10.1) family. [View classification]

Caution: Could be the product of a pseudogene. Strain K12 contains a truncated, inactive permease due to a frameshift in position 34 that produces two separate ORFs. The sequence shown here is a reconstruction originating from EcoGene.

Sequence caution: The sequence AP009048 differs from that shown. Reason: Frameshift at position 34. The sequence U00096 differs from that shown. Reason: Frameshift at position 34.

Similar Products

Product Notes

The Putative inactive ferrous iron permease EfeU (efeU) efeu (Catalog #AAA1025576) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-276. The amino acid sequence is listed below: MFVPFLIMLR EGLEAALIVS LIASYLKRTQ RGMXDCVMWI GVLLAAALCL GLGIFINETT GEFPQKEQEL FEGIVAVIAV VILTWMVFWM RKVSRNVKVQ LEQAVDSALQ RGNHHGWALV MMVFFAVARE GLESVFFLLA AFQQDVGIWP PLGAMLGLAT AVVLGFLLYW GGIRLNLGAF FKWTSLFILF VAAGLAAGAI RAFHEAGLWN HFQEIAFDMS AVLSTHSLFG TLMEGIFGYQ EAPSVSEVAV WFIYLIPALV AFALPPRAGA TASRSA. It is sometimes possible for the material contained within the vial of "Putative inactive ferrous iron permease EfeU (efeU), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.