Ectodysplasin-A receptor-associated adapter protein (Edaradd) Recombinant Protein | Edaradd recombinant protein
Recombinant Mouse Ectodysplasin-A receptor-associated adapter protein (Edaradd)
Gene Names
Edaradd; cr; A630043P06; 1810032E07Rik; 5830469M23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ectodysplasin-A receptor-associated adapter protein (Edaradd); Recombinant Mouse Ectodysplasin-A receptor-associated adapter protein (Edaradd); Edaradd recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-208, full length protein
Sequence
MASPDDPLRSDHMAKEPVEDTDPSTLSFAMSDKYPIQDTGLPKAKECDTVNSNCPPNSDDQPQGEENDFPDSTKDPLSGVSRNQPCKDRKGSCSCPSCSPRAPTISDLLNDQDLLDTIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLFRNSQRTVGQLMELCRLYHRADVEKILRRWVDEEWPHRGHSDSSMHF
Sequence Length
208
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Edaradd recombinant protein
This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. This protein is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23,753 Da
NCBI Official Full Name
Ectodysplasin-A receptor-associated adapter protein
NCBI Official Synonym Full Names
EDAR (ectodysplasin-A receptor)-associated death domain
NCBI Official Symbol
Edaradd
NCBI Official Synonym Symbols
cr; A630043P06; 1810032E07Rik; 5830469M23Rik
NCBI Protein Information
ectodysplasin-A receptor-associated adapter protein
UniProt Protein Name
Ectodysplasin-A receptor-associated adapter protein
Protein Family
UniProt Gene Name
Edaradd
UniProt Synonym Gene Names
Cr
Uniprot Description
Adapter protein that interacts with EDAR DEATH domain and couples the receptor to EDA signaling pathway during morphogenesis of ectodermal organs. Mediates the activation of NF-kappa-B ().
Research Articles on Edaradd
Similar Products
Product Notes
The Edaradd edaradd (Catalog #AAA1387432) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-208, full length protein. The amino acid sequence is listed below: MASPDDPLRS DHMAKEPVED TDPSTLSFAM SDKYPIQDTG LPKAKECDTV NSNCPPNSDD QPQGEENDFP DSTKDPLSGV SRNQPCKDRK GSCSCPSCSP RAPTISDLLN DQDLLDTIRI KLDPCHPTVK NWRNFASKWG MPYDELCFLE QRPQSPTLEF LFRNSQRTVG QLMELCRLYH RADVEKILRR WVDEEWPHRG HSDSSMHF. It is sometimes possible for the material contained within the vial of "Ectodysplasin-A receptor-associated adapter protein (Edaradd), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
