SDS-Page
Endothelin-converting enzyme-like 1 (Ecel1) Recombinant Protein | Ecel1 recombinant protein
Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1), partial
Gene Names
Ecel1; xce; DINE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Endothelin-converting enzyme-like 1 (Ecel1); Recombinant Mouse Endothelin-converting enzyme-like 1 (Ecel1); partial; Ecel1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-61aa; Partial
Sequence
MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC
Sequence Length
61
Species
Mouse
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for Ecel1 recombinant protein
This gene encodes a member of the M13 family of endopeptidases. In general, M13 family members are zinc-containing type II integral-membrane proteins that are important regulators of neuropeptide and peptide hormone activity. This gene is expressed specifically in the central nervous system and its protein localizes predominately to the endoplasmic reticulum or, in trace amounts, to the cell surface. Disruption of this gene in mouse embryonic stem cells results in neonatal lethality due to respiratory failure shortly after birth. Based on the specific expression of this gene and the phenotype of the gene deficiency in mouse embryos, it is suggested that this protein plays a critical role in neural regulation of the respiratory system. This gene has multiple pseudogenes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13.7 kDa
NCBI Official Full Name
endothelin-converting enzyme-like 1
NCBI Official Synonym Full Names
endothelin converting enzyme-like 1
NCBI Official Symbol
Ecel1
NCBI Official Synonym Symbols
xce; DINE
NCBI Protein Information
endothelin-converting enzyme-like 1
UniProt Protein Name
Endothelin-converting enzyme-like 1
Protein Family
UniProt Gene Name
Ecel1
UniProt Synonym Gene Names
Dine; Xce
Uniprot Description
May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides.
Research Articles on Ecel1
Similar Products
Product Notes
The Ecel1 ecel1 (Catalog #AAA1482544) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-61aa; Partial. The amino acid sequence is listed below: MEAPYSMTAH YDEFQEVKYV SRCGTGGARG TSLPPGFPRG SGRSASGSRS GLPRWNRREV C. It is sometimes possible for the material contained within the vial of "Endothelin-converting enzyme-like 1 (Ecel1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
