Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp) Recombinant Protein | Ebp recombinant protein

Recombinant Mouse 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)

Gene Names
Ebp; Td; mSI; Pabp; AI255399
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
3-beta-hydroxysteroid-Delta (8); Delta (7)-isomerase (Ebp); Recombinant Mouse 3-beta-hydroxysteroid-Delta (8); Recombinant 3-beta-hydroxysteroid-Delta (8); 3-beta-hydroxysteroid-Delta(8); Delta(7)-isomerase EC= 5.3.3.5; Cholestenol Delta-isomerase Delta(8)-Delta(7) sterol isomerase; D8-D7 sterol isomerase Emopamil-binding protein; Ebp recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-230
Sequence
TTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAGRRLALCWFAVCTFIHLVIEGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFVVCMETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMGQIYGDVLYFLTELHEGLQHGEIGHPVYFWFYFVFLNAVWLVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN
Sequence Length
230
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,215 Da
NCBI Official Full Name
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
NCBI Official Synonym Full Names
phenylalkylamine Ca2+ antagonist (emopamil) binding protein
NCBI Official Symbol
Ebp
NCBI Official Synonym Symbols
Td; mSI; Pabp; AI255399
NCBI Protein Information
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase; tattered; D8-D7 sterol isomerase; emopamil-binding protein; cholestenol Delta-isomerase; delta(8)-Delta(7) sterol isomerase
UniProt Protein Name
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
UniProt Gene Name
Ebp
UniProt Synonym Gene Names
Msi; D8-D7 sterol isomerase
UniProt Entry Name
EBP_MOUSE

NCBI Description

This gene encodes a transmembrane protein that localizes to the endoplasmic reticulum. This protein catalyses the conversion of delta8 to delta7 sterols, an important step in sterol biosynthesis. Mutations in this gene are responsible for the mouse tattered mutant phenotype. Tattered males are embryonic lethal, while heterozygous females have developmental defects. Deficiency of the related gene in human causes X-linked dominant chondrodysplasia punctata. [provided by RefSeq, May 2015]

Uniprot Description

EBP: Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers. Defects in EBP are the cause of chondrodysplasia punctata X-linked dominant type 2 (CDPX2); also known as Conradi-Hunermann-Happle syndrome. CDP is a clinically and genetically heterogeneous disorder characterized by punctiform calcification of the bones. The key clinical features of CDPX2 are chondrodysplasia punctata, linear ichthyosis, cataracts and short stature. CDPX2 is a rare disorder of defective cholesterol biosynthesis, biochemically characterized by an increased amount of 8-dehydrocholesterol and cholest-8(9)-en-3-beta-ol in the plasma and tissues. Belongs to the EBP family.

Protein type: EC 5.3.3.5; Membrane protein, integral; Endoplasmic reticulum; Lipid Metabolism - steroid biosynthesis; Isomerase; Membrane protein, multi-pass

Cellular Component: endoplasmic reticulum membrane; membrane; intracellular membrane-bound organelle; endoplasmic reticulum; integral to membrane

Molecular Function: isomerase activity; cholestenol delta-isomerase activity; C-8 sterol isomerase activity

Biological Process: steroid metabolic process; cholesterol metabolic process; sterol biosynthetic process; hemopoiesis; lipid metabolic process; cholesterol biosynthetic process; steroid biosynthetic process; sterol metabolic process

Research Articles on Ebp

Similar Products

Product Notes

The Ebp ebp (Catalog #AAA955342) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-230. The amino acid sequence is listed below: TTNTVPLHPY WPRHLKLDNF VPNDLPTSHI LVGLFSISGG LIVITWLLSS RASVVPLGAG RRLALCWFAV CTFIHLVIEG WFSLYNGILL EDQAFLSQLW KEYSKGDSRY ILSDSFVVCM ETVTACLWGP LSLWVVIAFL RQQPFRFVLQ LVVSMGQIYG DVLYFLTELH EGLQHGEIGH PVYFWFYFVF LNAVWLVIPS ILVLDAIKHL TSAQSVLDSK VMKIKSKHN. It is sometimes possible for the material contained within the vial of "3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.