SDS-Page
Epstein-Barr nuclear antigen 2 (EBNA2) Recombinant Protein | EBNA2 recombinant protein
Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Epstein-Barr nuclear antigen 2 (EBNA2); Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2); Epstein-Barr nuclear antigen 2; EBNA-2; EBV nuclear antigen 2; EBNA2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
247-454aa; Partial
Sequence
SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ
Species
Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25.9 kDa
NCBI Official Full Name
EBNA-2
NCBI Official Symbol
HHV4tp2_gp06
NCBI Protein Information
latency protein; EBNA-2
UniProt Protein Name
Epstein-Barr nuclear antigen 2
Protein Family
UniProt Gene Name
EBNA2
UniProt Synonym Gene Names
EBNA-2; EBV nuclear antigen 2
UniProt Entry Name
EBNA2_EBVA8
Uniprot Description
Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells ().
Research Articles on EBNA2
Similar Products
Product Notes
The EBNA2 ebna2 (Catalog #AAA1421898) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 247-454aa; Partial. The amino acid sequence is listed below: SYSIPSMTLS PEPLPPPAAP AHPLPGVIYD QQALPPTPGP PWWPPVRDPT PTTQTPPTNT KQGPDQGQGR GRWRGRGRSK GRGRMHKLPE PRRPGPDTSS PSMPQLSPVV SLHQGQGPEN SPTPGPSTAG PVCRVTPSAT PDISPIHEPE SSDSEEPPFL FPSDWYPPTL EPAELDESWE GIFETTESHS SDEENVGGPS KRPRTSTQ. It is sometimes possible for the material contained within the vial of "Epstein-Barr nuclear antigen 2 (EBNA2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
