Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Thioredoxin Active Protein | TXN1 active protein

Recombinant E Coli Thioredoxin

Gene Names
trxA; dasC; ECK3773; fip; fipA; JW5856; tsnC
Purity
Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Thioredoxin; Recombinant E Coli Thioredoxin; TXN1 E.Coli; Thioredoxin E.Coli Recombinant; Thioredoxin-1; Trx-1; trxA; fipA; tsnC; b3781; JW5856; TXN1 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 90.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Each mg of protein contains 20mM phosphate buffer pH 7.4.
Sterile Lyophilized Powder.
Sequence
HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA
Sequence Length
109
Solubility
It is recommended to reconstitute the lyophilized TRX in sterile 18M Omega -cm H2O.
Biological Activity
TRX activity is assayed by measuring the change in absorbance at 650 nm at 25 degree C using 0.13 uM bovine insulin containing 0.33mM DTT (pH 6.5).The specific activity was found to be 3IU/mg.
Preparation and Storage
TRX although stable at 4 degree C for 3 weeks, should be stored desiccated below -18 degree C. Please prevent freeze thaw cycles.
Related Product Information for TXN1 active protein
Description: Recombinant Thioredoxin was purified from E Coli harboring its gene.

Introduction: Thioredoxins are small disulphide-containing redox proteins (within the conserved Cys-Gly-Pro-Cys active site) that have been found in all the kingdoms of living organisms. Thioredoxin contains a single disulfide active site and serves as a general protein disulphide oxidoreductase. Thioredoxins are involved in the first unique step in DNA synthesis. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. Trx also provides control over a number of transcription factors affecting cell proliferation and death through a mechanism referred to as redox regulation. It has been suggested that thioredoxin may catalyze the formation of correct disulfides during protein folding because of its ability to act as an efficient oxidoreductant. This could be especially useful in refolding proteins expressed in E. coli. To this end, thioredoxin has been shown to act as a protein disulfide isomerase.Its Molecular Weight is 11.9kDa. and the pI is 4.67.
Product Categories/Family for TXN1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,807 Da
NCBI Official Full Name
thioredoxin 1
NCBI Official Symbol
trxA
NCBI Official Synonym Symbols
dasC; ECK3773; fip; fipA; JW5856; tsnC
NCBI Protein Information
thioredoxin 1
UniProt Protein Name
Thioredoxin-1
Protein Family
UniProt Gene Name
trxA
UniProt Synonym Gene Names
fipA; tsnC; Trx-1
UniProt Entry Name
THIO_ECOLI

NCBI Description

Thioredoxins are small electron-transfer proteins which contain a cysteine disulfide/dithiol active site. [More information is available at EcoCyc: EG11031].

Uniprot Description

Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.

Research Articles on TXN1

Similar Products

Product Notes

The TXN1 trxa (Catalog #AAA142889) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: HMSDKIIHL TDDSFDTDVL KADGAIL VDFW AEWCGPCKMI APILDEI GKLTVAKLNI DQNPGTAPKY GIRGIPTLLL FKNGEVAATK VGAL DANLA. It is sometimes possible for the material contained within the vial of "Thioredoxin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.