Programmed cell death 1 ligand 1 (CD274) Active Protein | CD274 active protein

Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial (Active)

Cat. Num. AAA9018432

• Gene Names: CD274; B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Programmed cell death 1 ligand 1 (CD274); Recombinant Human Programmed cell death 1 ligand 1 (CD274); partial (Active); PD-L1 (PDCD1 ligand 1)(Programmed death ligand 1)(hPD-L1)(B7 homolog 1)(B7-H1)(CD274); CD274 active protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-238aa, Partial
• Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

• Species: Homo sapiens (Human)
• Endotoxin: Less than 1.0EU/ug as determined by LAL method.
• Relevance: Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813417, PubMed:28813410). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed:11015443, PubMed:28813417, PubMed:28813410). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10)(PubMed:10581077)The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed:28813417, PubMed:28813410). The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity). The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity).
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2ug/mL can bind Anti- PD-L1 mouse monoclonal antibody , the EC50 of human PD-L1 protein is 1.252-1.653ng/mL.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Product Categories/Family for CD274 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 390979639
• NCBI GeneID: 29126
• NCBI Accession #: NP_001254635.1
• NCBI GenBank Nucleotide #: NM_001267706.1
• UniProt Accession #: Q9NZQ7; Q14CJ2; Q2V8D5; Q66RK1; Q6WEX4; Q9NUZ5; B2RBA2; B4DU27
• Molecular Weight: 33,275 Da
• NCBI Official Full Name: programmed cell death 1 ligand 1 isoform b
• NCBI Official Synonym Full Names: CD274 molecule
• NCBI Official Symbol: CD274
• NCBI Official Synonym Symbols: B7-H; B7H1; PDL1; PD-L1; PDCD1L1; PDCD1LG1
• NCBI Protein Information: programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1; programmed death ligand 1
• UniProt Protein Name: Programmed cell death 1 ligand 1
• Protein Family: Programmed cell death
• UniProt Gene Name: CD274
• UniProt Synonym Gene Names: B7H1; PDCD1L1; PDCD1LG1; PDL1; PD-L1; PDCD1 ligand 1; Programmed death ligand 1; B7-H1
• UniProt Entry Name: PD1L1_HUMAN

Uniprot Description

CD274: Involved in the costimulatory signal, essential for T- cell proliferation and production of IL10 and IFNG, in an IL2- dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p24

Cellular Component: plasma membrane; integral to membrane; endomembrane system; external side of plasma membrane

Molecular Function: protein binding

Biological Process: regulation of activated T cell proliferation; cell surface receptor linked signal transduction; negative regulation of interleukin-10 production; negative regulation of interferon-gamma production; negative regulation of activated T cell proliferation; T cell costimulation; immune response; positive regulation of T cell proliferation; signal transduction