SCF active protein

Mouse SCF

Cat. Num. AAA691568

• Gene Names: Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
• Reactivity: Mouse
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: SCF; Mouse SCF; Recombinant Mouse Stem Cell Factor (SCF); Hematopoietic growth factor KL; c-Kit ligand; SCF active protein

• Host: E Coli
• Reactivity: Mouse
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQ LSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPK RPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT KPFMLPPVA
• Sequence Length: 165

• Endotoxin Level: < 0.1ng/ug of mSCF
• Length (aa): 165
• Biological Activity: The ED₅₀ as determined by the dose-depend stimulation of the proliferation of the human TF-1 cell line is in the range of 2-10 ng/ml.
• Buffer: 0.5X PBS
• Gene: Kitlg
• Reconstitution: Mouse SCF should be reconstituted in 50mM acetis acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20 degree C.
• Preparation and Storage: The lyophilized mouse SCF is best stored desiccated below 0 degree C. Freeze/thaw cycles will result in significant loss of activity. Avoid repeated freeze-thaw cycles.

Testing Data #2

Test Data

(Proliferation assay with TF-I cells.)

Related Product Information for SCF active protein

Stem cell factor (SCF), also known as ckit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acid (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble. An alternately spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform, mouse SCF shares 93% aa sequence identity with rat SCF and 72%-75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Noncovalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/ckit to trigger receptor dimerization and signaling.

Product Categories/Family for SCF active protein

Cytokines & Growth Factors

References

1. Ashman LK Int J Biochem Cell Biol 31 (1999) 2. Sette et al, Int J Dev Biol 44 (2000) 5. Kapur et al, Blood 100 (2002) 6. Wang et al, Arterioscler Thromb Vasc Biol 27 (2007) 7. Bashamboo et al, J Cell Sci 119 (2006) 10. Arakawa et al, J Biol Chem 266 (1991) 13. Flanagan et al, Cell 64 (1991) 14. Martin et al, Cell 63 (1990) 15. Lemmon et al, J Biol Chem 272 (1997)

NCBI and Uniprot Product Information

• NCBI GI #: 7305267
• NCBI GeneID: 17311
• NCBI Accession #: NP_038626.1
• NCBI GenBank Nucleotide #: NM_013598.2
• UniProt Accession #: P20826; P97332; Q3TNJ7; Q62524; Q64222; Q921N5
• Molecular Weight: 18.42 kDa
• NCBI Official Full Name: kit ligand
• NCBI Official Synonym Full Names: kit ligand
• NCBI Official Symbol: Kitl
• NCBI Official Synonym Symbols: Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted
• NCBI Protein Information: kit ligand; cloud gray; C-kit ligand; Steel factor; grizzle-belly; stem cell factor; mast cell growth factor; hematopoietic growth factor KL
• UniProt Protein Name: Kit ligand
• Protein Family: SCF-associated factor
• UniProt Gene Name: Kitlg
• UniProt Synonym Gene Names: Kitl; Mgf; Sl; Slf; MGF; SCF; sKITLG
• UniProt Entry Name: SCF_MOUSE

Uniprot Description

Function: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Subunit structure: Homodimer, non-covalently linked

Probable. Heterotetramer with KIT, binding two KIT molecules; thereby mediates KIT dimerization and subsequent activation by autophosphorylation. Ref.14

Subcellular location: Isoform 1: Cell membrane; Single-pass type I membrane protein

By similarity. Isoform 2: Cell membrane; Single-pass type I membrane protein

By similarity. Cytoplasm › cytoskeleton

By similarity. Soluble KIT ligand: Secreted

By similarity.

Developmental stage: Acts in the early stages of hematopoiesis.

Post-translational modification: A soluble form is produced by proteolytic processing of isoform 1 in the extracellular domain.

Sequence similarities: Belongs to the SCF family.