Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Proliferation marker protein Ki-67 Protein | MKI67 protein

Proliferation marker protein Ki-67

Gene Names
MKI67; KIA; MIB-; MIB-1; PPP1R105
Applications
ELISA, Western Blot
Purity
>95%
Synonyms
Proliferation marker protein Ki-67; Antigen identified by monoclonal antibody Ki-67; Antigen KI-67; MKI67 protein
Ordering
Host
E Coli
Purity/Purification
>95%
Form/Format
Liquid
Concentration
1 mg/mL (varies by lot)
Sequence
EKTTKIACKSPPPESVDTPTSTKQWPKRSLRKADVEEEFLALRKLTPSAGKAMLTPKPAGGDEKDIKAFMGTPVQKLDLAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTP
Sequence Length
2896
Applicable Applications for MKI67 protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP)
Organism Species
Homo sapiens(human)
Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10% glycerol(PH8).0).
Preparation and Storage
Store at -20°C for 6 months. (Avoid repeated freezing and thawing).

SDS-PAGE

SDS-PAGE
Related Product Information for MKI67 protein
Recombinant protein with His-tag

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.43 kD
NCBI Official Full Name
proliferation marker protein Ki-67 isoform 2
NCBI Official Synonym Full Names
marker of proliferation Ki-67
NCBI Official Symbol
MKI67
NCBI Official Synonym Symbols
KIA; MIB-; MIB-1; PPP1R105
NCBI Protein Information
proliferation marker protein Ki-67
UniProt Protein Name
Proliferation marker protein Ki-67
UniProt Gene Name
MKI67
UniProt Synonym Gene Names
Antigen KI-67Curated; Antigen Ki67Curated

NCBI Description

This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. [provided by RefSeq, Mar 2009]

Uniprot Description

Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable).

Research Articles on MKI67

Similar Products

Product Notes

The MKI67 mki67 (Catalog #AAA2889438) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Proliferation marker protein Ki-67 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP). Researchers should empirically determine the suitability of the MKI67 mki67 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKTTKIACKS PPPESVDTPT STKQWPKRSL RKADVEEEFL ALRKLTPSAG KAMLTPKPAG GDEKDIKAFM GTPVQKLDLA GTLPGSKRQL QTPKEKAQAL EDLAGFKELF QTP. It is sometimes possible for the material contained within the vial of "Proliferation marker protein Ki-67, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.