Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Macrophage Migration Inhibitor Factor Active Protein | MIF active protein

Recombinant Human Macrophage Migration Inhibitor Factor

Gene Names
MIF; GIF; GLIF; MMIF
Purity
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Macrophage Migration Inhibitor Factor; Recombinant Human Macrophage Migration Inhibitor Factor; MIF Human; Active; Macrophage Migration Inhibitory Factor Human Recombinant (Active); Phenylpyruvate tautomerase; Glycosylation-inhibiting factor; GIF; MMIF; MIF; MIF (Active); MIF active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Sequence Length
115
Solubility
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18M Omega -cm H2O at a concentration between 0.1mg-1mg per 1ml.
Biological Activity
Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.
Preparation and Storage
Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution MIF-protein should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for MIF active protein
Description: MIF human Recombinant was cloned into an E Coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.

Introduction: The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,476 Da
NCBI Official Full Name
macrophage migration inhibitory factor
NCBI Official Synonym Full Names
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol
MIF
NCBI Official Synonym Symbols
GIF; GLIF; MMIF
NCBI Protein Information
macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase
UniProt Protein Name
Macrophage migration inhibitory factor
UniProt Gene Name
MIF
UniProt Synonym Gene Names
GLIF; MMIF; MIF; GIF
UniProt Entry Name
MIF_HUMAN

NCBI Description

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]

Uniprot Description

MIF: a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. Also acts as a phenylpyruvate tautomerase.

Protein type: Amino Acid Metabolism - tyrosine; Cytokine; Apoptosis; Amino Acid Metabolism - phenylalanine; Cell development/differentiation; Isomerase; EC 5.3.3.12; EC 5.3.2.1

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: nucleoplasm; extracellular space; cell surface; cytoplasm; extracellular region; vesicle

Molecular Function: phenylpyruvate tautomerase activity; protein binding; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity; dopachrome isomerase activity; chemoattractant activity; receptor binding

Biological Process: DNA damage response, signal transduction by p53 class mediator; regulation of macrophage activation; carboxylic acid metabolic process; positive regulation of lipopolysaccharide-mediated signaling pathway; cell aging; negative regulation of cellular protein metabolic process; prostaglandin biosynthetic process; positive regulation of peptidyl-serine phosphorylation; negative regulation of DNA damage response, signal transduction by p53 class mediator; positive regulation of MAP kinase activity; cell proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of fibroblast proliferation; negative regulation of myeloid cell apoptosis; negative regulation of mature B cell apoptosis; cell surface receptor linked signal transduction; positive chemotaxis; positive regulation of B cell proliferation; innate immune response; inflammatory response; positive regulation of phosphorylation; positive regulation of cytokine secretion; negative regulation of apoptosis

Disease: Rheumatoid Arthritis, Systemic Juvenile

Research Articles on MIF

Similar Products

Product Notes

The MIF mif (Catalog #AAA143330) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC SLHSIGKIGG AQNRSYSKLL CGLLAERLRI SPDRVYINYY DMNAANVGWN NSTFA. It is sometimes possible for the material contained within the vial of "Macrophage Migration Inhibitor Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.