Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Epstein Barr Virus Induced 3 Active Protein | EBI3 active protein

Recombinant Human Epstein Barr Virus Induced 3

Gene Names
EBI3; IL27B; IL-27B
Purity
Greater than 90% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Epstein Barr Virus Induced 3; Recombinant Human Epstein Barr Virus Induced 3; EBI3 Human; Epstein Barr Virus Induced 3 Human Recombinant; Interleukin-27 subunit beta; IL-27 subunit beta; IL-27B; Epstein-Barr virus-induced gene 3 protein; EBV-induced gene 3 protein; EBI3; IL27B; EBI3 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 90% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Sequence Length
229
Solubility
It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Preparation and Storage
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution EBI3 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. Please prevent freeze-thaw cycles.
Related Product Information for EBI3 active protein
Description: EBI3 Human Recombinant produced in E Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques.

Introduction: EBI3 has an induced expression in B lymphocytes in reaction to Epstein-Barr virus infection. EBI3 encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form iIL-27. EBI3 drives rapid clonal expansion of naive cd4(+) t-cells. EBI3 strongly synergizes with IL-12 to activate IFN-gamma production of naive cd4(+) t-cells. EBI3 mediates its biologic effects through the cytokine receptor wsx-1/tccr.
Product Categories/Family for EBI3 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,396 Da
NCBI Official Full Name
interleukin-27 subunit beta
NCBI Official Synonym Full Names
Epstein-Barr virus induced 3
NCBI Official Symbol
EBI3
NCBI Official Synonym Symbols
IL27B; IL-27B
NCBI Protein Information
interleukin-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; IL-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; epstein-Barr virus-induced gene 3 protein
UniProt Protein Name
Interleukin-27 subunit beta
Protein Family
UniProt Gene Name
EBI3
UniProt Synonym Gene Names
IL27B; IL-27 subunit beta; IL-27B; EBV-induced gene 3 protein
UniProt Entry Name
IL27B_HUMAN

NCBI Description

This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008]

Uniprot Description

IL27-beta: Cytokine with pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. Belongs to the type I cytokine receptor family. Type 3 subfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; interleukin-27 receptor binding; cytokine activity

Biological Process: T-helper 1 type immune response; cytokine and chemokine mediated signaling pathway; positive regulation of alpha-beta T cell proliferation; humoral immune response; positive regulation of interferon-gamma biosynthetic process

Research Articles on EBI3

Similar Products

Product Notes

The EBI3 ebi3 (Catalog #AAA144125) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RKGPPAALTL PRVQCRASRY PIAVDCSWTL PPAPNSTSPV SFIATYRLGM AARGHSWPCL QQTPTSTSCT ITDVQLFSMA PYVLNVTAVH PWGSSSSFVP FITEHIIKPD PPEGVRLSPL AERQLQVQWE PPGSWPFPEI FSLKYWIRYK RQGAARFHRV GPIEATSFIL RAVRPRARYY VQVAAQDLTD YGELSDWSLP ATATMSLGK. It is sometimes possible for the material contained within the vial of "Epstein Barr Virus Induced 3, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.