Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fatty Acid Binding Protein (FABP) Antigen | FABP antigen

Fatty Acid Binding Protein (FABP) Antigen

Gene Names
FABP7; MRG; BLBP; FABPB; B-FABP
Applications
ELISA, Western Blot
Purity
>95% by SDS-PAGE
Synonyms
Fatty Acid Binding Protein (FABP); Fatty Acid Binding Protein (FABP) Antigen; FABP antigen
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Purified Recombinant Antigen (His-tag)
135 mM NaCl, 2.7 mM KCl, 1.5 mM KH2PO4, 8 mM K2HPO4, pH 7.2
Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEALEHHHHHH
Sequence Length
132
Applicable Applications for FABP antigen
ELISA (EIA), Western Blot (WB), Immunogen
Preparation and Storage
Short Term (? 1 week): 2-8 degree C. Long Term: ?-20 degree C. Avoid repeated freezing and thawing.
Product Categories/Family for FABP antigen

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
15.9 kDa
NCBI Official Full Name
fatty acid binding protein
NCBI Official Synonym Full Names
fatty acid binding protein 7
NCBI Official Symbol
FABP7
NCBI Official Synonym Symbols
MRG; BLBP; FABPB; B-FABP
NCBI Protein Information
fatty acid-binding protein, brain
UniProt Protein Name
Fatty acid-binding protein, brain
UniProt Gene Name
FABP7
UniProt Synonym Gene Names
BLBP; FABPB; MRG; BLBP; B-FABP

NCBI Description

The gene encodes a small, highly conserved cytoplasmic protein that bind long-chain fatty acids and other hydrophobic ligands. The encoded protein is important in the establishment of the radial glial fiber in the developing brain. Alternative splicing and promoter usage results in multiple transcript variants encoding different isoforms. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Jan 2016]

Uniprot Description

FABP7: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Cell cycle regulation; Cell development/differentiation; Lipid-binding

Chromosomal Location of Human Ortholog: 6q22.31

Cellular Component: cytosol; nucleoplasm

Biological Process: negative regulation of cell proliferation; nervous system development; triacylglycerol catabolic process

Research Articles on FABP

Similar Products

Product Notes

The FABP fabp7 (Catalog #AAA569294) is an Antigen produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Fatty Acid Binding Protein (FABP) can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Immunogen. Researchers should empirically determine the suitability of the FABP fabp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVDAFLGTWK LVDSKNFDDY MKSLGVGFAT RQVASMTKPT TIIEKNGDIL TLKTHSTFKN TEISFKLGVE FDETTADDRK VKSIVTLDGG KLVHLQKWDG QETTLVRELI DGKLILTLTH GTAVCTRTYE KEALEHHHHH H. It is sometimes possible for the material contained within the vial of "Fatty Acid Binding Protein (FABP), Antigen" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.