Sonic Hedgehog (Shh) Active Protein | Shh active protein

Recombinant Mouse Sonic Hedgehog Protein (Shh), Partial

Cat. Num. AAA7115176

• Gene Names: Shh; Hx; Dsh; Hhg1; Hxl3; ShhNC; M100081; 9530036O11Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Sonic Hedgehog (Shh); Recombinant Mouse Sonic Hedgehog Protein (Shh); Partial; Sonic Hedgehog Protein; SHH; HHG-1; Shh active protein

• Host: E Coli
• Specificity: Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4
• Sequence Positions: 25-198aa; Partial
• Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
• Sequence Length: 437

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
• Subcellular Location: Sonic hedgehog protein N-product: Cell Membrane, Lipid-Anchor
• Protein Families: Hedgehog Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Shh active protein

Relevance: Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH). Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases. Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa N-terminal fragment (Shh-N), and a catalytic-processing, glycosylated, 34 kDa, 239 aa C-terminal fragment. The 20 kDa Shh-N fragment is the core of the active hedgehog molecule. Mouse Shh-N is 99%, 98%, and 100% aa identical to human, rat and gerbil Shh-N, respectively.

Function: Sonic hedgehog protein.

Product Categories/Family for Shh active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 21617861
• NCBI GeneID: 20423
• NCBI Accession #: NP_033196.1
• NCBI GenBank Nucleotide #: NM_009170.3
• UniProt Accession #: Q62226
• Molecular Weight: 19.8 kDa
• NCBI Official Full Name: sonic hedgehog protein
• NCBI Official Synonym Full Names: sonic hedgehog
• NCBI Official Symbol: Shh
• NCBI Official Synonym Symbols: Hx; Dsh; Hhg1; Hxl3; ShhNC; M100081; 9530036O11Rik
• NCBI Protein Information: sonic hedgehog protein
• UniProt Protein Name: Sonic hedgehog protein
• Protein Family: Sonic hedgehog protein
• UniProt Gene Name: Shh
• UniProt Synonym Gene Names: Hhg1; SHH
• UniProt Entry Name: SHH_MOUSE

Uniprot Description

SHH: Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. Also regulates another target, the gli oncogene. Intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction. Interacts with HHATL/GUP1 which negatively regulates HHAT-mediated palmitoylation of the SHH N-terminus. N-product is active as a multimer. Expressed in fetal intestine, liver, lung, and kidney. Not expressed in adult tissues. Belongs to the hedgehog family.

Protein type: Cell development/differentiation; Oncoprotein; Cell cycle regulation; Motility/polarity/chemotaxis

Cellular Component: Golgi apparatus; extracellular space; cell surface; endoplasmic reticulum; dendrite; extracellular region; lipid raft; proteinaceous extracellular matrix; transport vesicle; membrane; cell soma; axon; plasma membrane; nucleus

Molecular Function: laminin-1 binding; peptidase activity; protein binding; glycosaminoglycan binding; zinc ion binding; hydrolase activity; metal ion binding; patched binding; calcium ion binding; glycoprotein binding

Biological Process: prostate gland development; skin development; developmental growth; central nervous system development; positive regulation of transcription, DNA-dependent; embryonic skeletal development; mesenchymal cell proliferation; telencephalon regionalization; embryonic foregut morphogenesis; positive regulation of mesenchymal cell proliferation; male genitalia development; anatomical structure formation; oligodendrocyte differentiation; kidney development; neural crest cell migration; inner ear development; embryonic limb morphogenesis; hindbrain development; positive regulation of neuroblast proliferation; tongue morphogenesis; camera-type eye development; cell fate commitment; myotube differentiation; neuron fate commitment; intermediate filament organization; osteoblast development; positive regulation of skeletal muscle cell proliferation; response to ethanol; positive regulation of photoreceptor cell differentiation; regulation of gene expression; positive regulation of cell division; regulation of proteolysis; striated muscle cell differentiation; embryonic organ development; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; neural tube formation; determination of left/right symmetry; negative regulation of protein catabolic process; negative regulation of apoptosis; embryonic forelimb morphogenesis; limb development; axon guidance; granule cell precursor proliferation; spinal cord dorsal/ventral patterning; positive regulation of striated muscle cell differentiation; negative regulation of transcription from RNA polymerase II promoter; thalamus development; palate development; signal transduction; Bergmann glial cell differentiation; negative regulation of T cell proliferation; positive regulation of cell proliferation; forebrain development; pancreas development; thyroid gland development; embryonic morphogenesis; heart looping; angiogenesis; vasculogenesis; ventral spinal cord interneuron specification; negative regulation of cell migration; positive thymic T cell selection; positive regulation of granule cell precursor proliferation; gut mesoderm development; intein-mediated protein splicing; regulation of odontogenesis; androgen metabolic process; spinal cord motor neuron differentiation; pattern specification process; odontogenesis of dentine-containing teeth; regulation of cell proliferation; cell proliferation; negative regulation of cell differentiation; stem cell development; embryonic development; dorsal/ventral pattern formation; positive regulation of protein import into nucleus; ureteric bud branching; hindgut morphogenesis; positive regulation of neuron differentiation; lung development; negative regulation of alpha-beta T cell differentiation; negative regulation of Wnt receptor signaling pathway; anatomical structure development; multicellular organismal development; heart development; CD4-positive or CD8-positive, alpha-beta T cell lineage commitment; T cell differentiation in the thymus; lymphoid progenitor cell differentiation; Wnt receptor signaling pathway through beta-catenin; proteolysis; anterior/posterior pattern formation; positive regulation of T cell differentiation in the thymus; cell-cell signaling; hair follicle development; embryonic digestive tract morphogenesis; midbrain development; ectoderm development; positive regulation of smoothened signaling pathway; positive regulation of oligodendrocyte differentiation; oligodendrocyte development; activation of hh target transcription factor; striated muscle development; endocytosis; digestive tract morphogenesis; positive regulation of skeletal muscle development; negative thymic T cell selection; patterning of blood vessels; branching morphogenesis of a tube; polarity specification of anterior/posterior axis; positive regulation of cell differentiation; metanephros development; tongue development; apoptosis; cell fate specification; embryonic hindlimb morphogenesis; odontogenesis; vasculature development; regulation of transcription, DNA-dependent; male genitalia morphogenesis; cell communication; response to axon injury; positive regulation of Wnt receptor signaling pathway; dorsoventral neural tube patterning; organ formation; smoothened signaling pathway; hair follicle morphogenesis; thymus development; smoothened signaling pathway in regulation of granule cell precursor cell proliferation; respiratory tube development; positive regulation of immature T cell proliferation in the thymus; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; formation of anatomical boundary; myoblast differentiation; limb bud formation; establishment of cell polarity; neuroblast proliferation; blood coagulation; cell development; positive regulation of alpha-beta T cell differentiation