Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human S100A12 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 10 kDa.)

S100A12 active protein

Recombinant Human S100A12 Protein

Gene Names
S100A12; p6; CAGC; CGRP; MRP6; CAAF1; MRP-6; ENRAGE
Purity
>97% by SDS-PAGE.
Synonyms
S100A12; Recombinant Human S100A12 Protein; CAAF1; CAGC; CGRP; ENRAGE; MRP-6; MRP6; p6; S100A12 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Sequence Length
92
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. When rhRAGE/Fc Chimera is coated at 2 ug/mL (100 uL/well), rhS100A12 binds with an apparent KD
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human S100A12 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 10 kDa.)

SDS-Page (Recombinant Human S100A12 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at approximately 10 kDa.)
Related Product Information for S100A12 active protein
Description: Recombinant Human S100A12 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100A12 (Accession #NP_005612.1) fused with a 6xHis tag at the C-terminus.

Background: The protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 proteins include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
Product Categories/Family for S100A12 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Protein S100-A12
NCBI Official Synonym Full Names
S100 calcium binding protein A12
NCBI Official Symbol
S100A12
NCBI Official Synonym Symbols
p6; CAGC; CGRP; MRP6; CAAF1; MRP-6; ENRAGE
NCBI Protein Information
protein S100-A12
UniProt Protein Name
Protein S100-A12
Protein Family
UniProt Gene Name
S100A12
UniProt Synonym Gene Names
CAAF1; CAGC; EN-RAGE; MRP-6; p6
UniProt Entry Name
S10AC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. [provided by RefSeq, Nov 2014]

Uniprot Description

S100A12: S100A12 is a calcium-, zinc- and copper-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. Its proinflammatory activity involves recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to receptor for advanced glycation endproducts (AGER). Binding to AGER activates the MAP-kinase and NF-kappa-B signaling pathways leading to production of proinflammatory cytokines and up-regulation of cell adhesion molecules ICAM1 and VCAM1. Acts as a monocyte and mast cell chemoattractant. Can stimulate mast cell degranulation and activation which generates chemokines, histamine and cytokines inducing further leukocyte recruitment to the sites of inflammation. Can inhibit the activity of matrix metalloproteinases; MMP2, MMP3 and MMP9 by chelating Zn(2+) from their active sites. Possesses filariacidal and filariastatic activity. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. Belongs to the S-101 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytoskeleton; cytoplasm; extracellular region; plasma membrane; nucleus; cytosol

Molecular Function: protein binding; RAGE receptor binding; copper ion binding; zinc ion binding; calcium ion binding

Biological Process: neutrophil chemotaxis; positive regulation of MAP kinase activity; monocyte chemotaxis; positive regulation of I-kappaB kinase/NF-kappaB cascade; killing of cells of another organism; xenobiotic metabolic process; defense response to bacterium; innate immune response; inflammatory response; defense response to fungus; mast cell activation; cytokine secretion; activation of NF-kappaB transcription factor; positive regulation of inflammatory response

Research Articles on S100A12

Similar Products

Product Notes

The S100A12 s100a12 (Catalog #AAA9139612) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MTKLEEHLEG IVNIFHQYSV RKGHFDTLSK GELKQLLTKE LANTIKNIKD KAVIDEIFQG LDANQDEQVD FQEFISLVAI ALKAAHYHTH KE. It is sometimes possible for the material contained within the vial of "S100A12, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.