SDS-PAGE
BTB/POZ domain-containing protein 2 Recombinant Protein | BTBD2 recombinant protein
Recombinant human BTB/POZ domain-containing protein 2 protein
Applications
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BTB/POZ domain-containing protein 2; Recombinant human BTB/POZ domain-containing protein 2 protein; BTBD2 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
MTIEEFAAGPAQSGILVDREVVSLFLHFTVNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNKRIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT
Applicable Applications for BTBD2 recombinant protein
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
SDS-PAGE
Related Product Information for BTBD2 recombinant protein
Interacts with topoisomerase 1 and with TRIM5 isoform Delta.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kD
NCBI Official Full Name
BTB/POZ domain-containing protein 2
NCBI Official Synonym Full Names
BTB (POZ) domain containing 2
NCBI Official Symbol
BTBD2
NCBI Protein Information
BTB/POZ domain-containing protein 2
UniProt Protein Name
BTB/POZ domain-containing protein 2
Protein Family
UniProt Gene Name
BTBD2
UniProt Entry Name
BTBD2_HUMAN
NCBI Description
The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. [provided by RefSeq, Jul 2008]
Uniprot Description
Subunit structure: Interacts with topoisomerase 1 and with TRIM5 isoform Delta. Ref.1 Ref.7
Subcellular location: Cytoplasm › P-body. Note: Cytoplasmic bodies. Ref.7
Sequence similarities: Contains 1 BTB (POZ) domain.
Sequence caution: The sequence AAC16070.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAB55143.1 differs from that shown. Reason: Erroneous initiation.
Research Articles on BTBD2
Similar Products
Product Notes
The BTBD2 btbd2 (Catalog #AAA717378) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's BTB/POZ domain-containing protein 2 can be used in a range of immunoassay formats including, but not limited to, Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week. Researchers should empirically determine the suitability of the BTBD2 btbd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTIEEFAAGP AQSGILVDRE VVSLFLHFTV NPKPRVEFID RPRCCLRGKE CSINRFQQVE SRWGYSGTSD RIRFSVNKRI FVVGFGLYGS IHGPTDYQVN IQIIHTDSNT VLGQNDTGFS CDGSASTFRV MFKEPVEVLP NVNYTACATL KGPDSHYGTK GLRKVTHESP TTGAKTCFTF CYAAGNNNGT SVEDGQIPEV IFYT. It is sometimes possible for the material contained within the vial of "BTB/POZ domain-containing protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
