Regulator of G-Protein Signaling 17 (RGS17) Active Protein | RGS17 active protein

Recombinant Human Regulator of G-Protein Signaling 17 (RGS17) (Active)

Cat. Num. AAA7135714

• Gene Names: RGS17; RGSZ2; RGS-17; hRGS17
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Regulator of G-Protein Signaling 17 (RGS17); Recombinant Human Regulator of G-Protein Signaling 17 (RGS17) (Active); RGS17; RGSZ2; RGS17 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid or Lyophilized Powder; If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, p
• Sequence Positions: 1-210aa; Full Length
• Sequence: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES
• Sequence Length: 210

• Species: Human
• Tag: N-terminal GST-tagged
• Endotoxin: Not test.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 ug/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 ug/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for RGS17 active protein

Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.

Product Categories/Family for RGS17 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 21361405
• NCBI GeneID: 26575
• NCBI Accession #: NP_036551.3
• NCBI GenBank Nucleotide #: NP_036551.3
• UniProt Accession #: Q9UGC6
• Molecular Weight: 51.4 kDa
• NCBI Official Full Name: regulator of G-protein signaling 17
• NCBI Official Synonym Full Names: regulator of G protein signaling 17
• NCBI Official Symbol: RGS17
• NCBI Official Synonym Symbols: RGSZ2; RGS-17; hRGS17
• NCBI Protein Information: regulator of G-protein signaling 17
• UniProt Protein Name: Regulator of G-protein signaling 17
• Protein Family: Regulator of G-protein signaling
• UniProt Gene Name: RGS17
• UniProt Synonym Gene Names: RGS17
• UniProt Entry Name: RGS17_HUMAN

NCBI Description

This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to activated, GTP-bound G alpha subunits and acting as a GTPase activating protein (GAP), increasing the rate of conversion of the GTP to GDP. This hydrolysis allows the G alpha subunits to bind G beta/gamma subunit heterodimers, forming inactive G-protein heterotrimers, thereby terminating the signal. [provided by RefSeq, Jul 2008]

Uniprot Description

RGS17: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G- protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.

Protein type: GAPs; GAPs, RGS

Chromosomal Location of Human Ortholog: 6q25.3

Cellular Component: cytoplasm; plasma membrane; nucleus

Molecular Function: GTPase activator activity

Biological Process: positive regulation of GTPase activity