Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

PHPT1 active protein

PHPT1, human recombinant

Gene Names
PHPT1; PHP14; CGI-202; HSPC141; HEL-S-132P
Purity
>95% by SDS-PAGE
Synonyms
PHPT1; human recombinant; bA216L13.10; CGI-202; DKFZp564M173; HSPC141; PHP14; RP11-216L13.10; 14 kDa phosphohistidine phosphatase; PHPT1 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Sequence
MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Gene Source
Human
Biological Activity
Specific activity >120 units/mg
Measured by its ability to hydrolyze 1nmol of p-nitrophenyl phosphate per minute at pH7.5 at 37 degree C.
Preparation and Storage
Store at -20 degree C
Centrifuge the vial prior to opening.
Shelf life: ~12 months

SDS-Page

SDS-Page
Related Product Information for PHPT1 active protein
PHPT1 is a 125 amino acid enzyme belonging to the Janus protein family. Existing as a monomer in the cytoplasm, PHPT1 is an EDTA-insensitive phosphohistidine phosphatase. Overexpression of PHPT1 leads to specific phosphohistidine phosphatase activity towards phosphopeptide I, with no activity detected towards phosphotyrosine, phosphothreonine and phosphoserine peptides. Enzyme that exhibits phosphohistidine phosphatase activity. Recombinant human PHPT1 protein, fused to His-tag at N-terminus, was expressed in E Coli and purified by using conventional chromatography techniques.
Product Categories/Family for PHPT1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
125
NCBI Official Full Name
14 kDa phosphohistidine phosphatase
NCBI Official Synonym Full Names
phosphohistidine phosphatase 1
NCBI Official Symbol
PHPT1
NCBI Official Synonym Symbols
PHP14; CGI-202; HSPC141; HEL-S-132P
NCBI Protein Information
14 kDa phosphohistidine phosphatase; protein janus-A homolog; sex-regulated protein janus-a; epididymis secretory sperm binding protein Li 132P
UniProt Protein Name
14 kDa phosphohistidine phosphatase
UniProt Gene Name
PHPT1
UniProt Synonym Gene Names
PHP14
UniProt Entry Name
PHP14_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

PHPT1: a phosphohistidine phosphatase. Present preferentially in heart and skeletal muscle. Insensitive to inhibition by okadaic acid and EDTA.

Protein type: Carbohydrate Metabolism - fructose and mannose; Phosphatase; Cofactor and Vitamin Metabolism - riboflavin; EC 3.1.3.-; Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - thiamine

Chromosomal Location of Human Ortholog: 9q34.3

Cellular Component: cytosol

Molecular Function: phosphohistidine phosphatase activity; calcium channel inhibitor activity; phosphoprotein phosphatase activity

Biological Process: negative regulation of lyase activity; negative regulation of T cell receptor signaling pathway; protein amino acid dephosphorylation

Research Articles on PHPT1

Similar Products

Product Notes

The PHPT1 phpt1 (Catalog #AAA849808) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MAVADLALIP DVDIDSDGVF KYVLIRVHSA PRSGAPAAES KEIVRGYKWA EYHADIYDKV SGDMQKQGCD CECLGGGRIS HQSQDKKIHV YGYSMAYGPA QHAISTEKIK AKYPDYEVTW ANDGY. It is sometimes possible for the material contained within the vial of "PHPT1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.