MIG active protein

Recombinant Human MIG (CXCL9)

Cat. Num. AAA142040

• Gene Names: CXCL9; CMK; MIG; Humig; SCYB9; crg-10
• Purity: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Synonyms: MIG; Recombinant Human MIG (CXCL9); MIG Human; MIG Human Recombinant (CXCL9); Small inducible cytokine B9; CXCL9; Gamma interferon-induced monokine; chemokine (C-X-C motif) ligand 9; CMK; Humig; SCYB9; crg-10; monokine induced by gamma-interferon; MIG active protein

• Host: E Coli
• Purity/Purification: Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
• Sequence Length: 125

• Solubility: It is recommended to reconstitute the lyophilized MIG in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
• Biological Activity: Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
• Preparation and Storage: Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CXCL9 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Related Product Information for MIG active protein

Description: MIG (monokine induced by gamma-interferon) Human Recombinant produced in E Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques.

Introduction: Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG). CXCL9 is a T-cell chemoattractant, which is induced by IFN-?. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.

Product Categories/Family for MIG active protein

Chemokines; MIG (CXCL9)

NCBI and Uniprot Product Information

• NCBI GI #: 4505187
• NCBI GeneID: 4283
• NCBI Accession #: NP_002407.1
• NCBI GenBank Nucleotide #: NM_002416.2
• UniProt Accession #: Q07325; Q503B4
• Molecular Weight: 14,019 Da
• NCBI Official Full Name: C-X-C motif chemokine 9
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 9
• NCBI Official Symbol: CXCL9
• NCBI Official Synonym Symbols: CMK; MIG; Humig; SCYB9; crg-10
• NCBI Protein Information: C-X-C motif chemokine 9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; small-inducible cytokine B9
• UniProt Protein Name: C-X-C motif chemokine 9
• Protein Family: Migration and invasion enhancer
• UniProt Gene Name: CXCL9
• UniProt Synonym Gene Names: CMK; MIG; SCYB9; HuMIG; MIG
• UniProt Entry Name: CXCL9_HUMAN

NCBI Description

This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL9: Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: protein binding; CXCR3 chemokine receptor binding; chemokine activity; cytokine activity

Biological Process: defense response; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of cAMP metabolic process; chemotaxis; signal transduction; positive regulation of myoblast differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; cell-cell signaling; cellular defense response; immune response; positive regulation of release of sequestered calcium ion into cytosol; inflammatory response; defense response to virus