Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Lymphotoxin-alpha (LTA) Active Protein | LTA active protein

Recombinant Human Lymphotoxin-alpha (LTA)

Gene Names
LTA; LT; TNFB; TNFSF1; TNLG1E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphotoxin-alpha (LTA); Recombinant Human Lymphotoxin-alpha (LTA); Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1; LTA active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
35-205aa; Full Length of Mature Protein
Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Sequence Length
66
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml.
Subcellular Location
Secreted, Membrane
Protein Families
Tumor Necrosis Factor Family
Classification
Cytokine
Subdivision
Tumor Necrosis Factor
Pathway
NF-kappaB Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for LTA active protein
Relevance: Tumor Necrosis Factor beta (TNF-beta) is a secreted protein belonging to the tumor necrosis factor family. TNF-beta binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF-beta forms heterotrimers with lymphotoxin-beta, which anchors TNF-beta to the cell surface. TNF-beta mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF-beta is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.

Function: Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Product Categories/Family for LTA active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
18.8 kDa
NCBI Official Full Name
lymphotoxin alpha, partial
NCBI Official Synonym Full Names
lymphotoxin alpha
NCBI Official Symbol
LTA
NCBI Official Synonym Symbols
LT; TNFB; TNFSF1; TNLG1E
NCBI Protein Information
lymphotoxin-alpha
UniProt Protein Name
Lymphotoxin-alpha
Protein Family
UniProt Gene Name
LTA
UniProt Synonym Gene Names
TNFB; TNFSF1; LT-alpha
UniProt Entry Name
TNFB_HUMAN

NCBI Description

The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

LTA: Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo. Genetic variations in LTA are a cause of susceptibility psoriatic arthritis (PSORAS). PSORAS is an inflammatory, seronegative arthritis associated with psoriasis. It is a heterogeneous disorder ranging from a mild, non-destructive disease to a severe, progressive, erosive arthropathy. Five types of psoriatic arthritis have been defined: asymmetrical oligoarthritis characterized by primary involvement of the small joints of the fingers or toes; asymmetrical arthritis which involves the joints of the extremities; symmetrical polyarthritis characterized by a rheumatoidlike pattern that can involve hands, wrists, ankles, and feet; arthritis mutilans, which is a rare but deforming and destructive condition; arthritis of the sacroiliac joints and spine (psoriatic spondylitis). Belongs to the tumor necrosis factor family.

Protein type: Secreted; Cytokine; Apoptosis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: extracellular space; membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: response to drug; positive regulation of humoral immune response mediated by circulating immunoglobulin; apoptosis; positive regulation of apoptosis; response to lipopolysaccharide; signal transduction; lymph node development; humoral immune response; defense response to Gram-positive bacterium; positive regulation of interferon-gamma production; cell-cell signaling; negative regulation of fibroblast proliferation; response to hypoxia; positive regulation of chronic inflammatory response to antigenic stimulus; response to nutrient

Disease: Psoriatic Arthritis, Susceptibility To; Myocardial Infarction, Susceptibility To; Leprosy, Susceptibility To, 4

Research Articles on LTA

Similar Products

Product Notes

The LTA lta (Catalog #AAA7115091) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-205aa; Full Length of Mature Protein. The amino acid sequence is listed below: LPGVGLTPSA AQTARQHPKM HLAHSTLKPA AHLIGDPSKQ NSLLWRANTD RAFLQDGFSL SNNSLLVPTS GIYFVYSQVV FSGKAYSPKA TSSPLYLAHE VQLFSSQYPF HVPLLSSQKM VYPGLQEPWL HSMYHGAAFQ LTQGDQLSTH TDGIPHLVLS PSTVFFGAFA L. It is sometimes possible for the material contained within the vial of "Lymphotoxin-alpha (LTA), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.