Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukemia Inhibitory Factor (LIF) Active Protein | LIF active protein

Recombinant Human Leukemia Inhibitory Factor (LIF)

Gene Names
LIF; CDF; DIA; HILDA; MLPLI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukemia Inhibitory Factor (LIF); Recombinant Human Leukemia Inhibitory Factor (LIF); Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; HILDA; LIF active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, 0.02% Tween 20, pH 7.4
Sequence Positions
23-202aa; Full Length of Mature Protein
Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Sequence Length
202
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the M1 cell differentiation assay is less than 0.8 ng/ml
Subcellular Location
Secreted
Protein Families
LIF/OSM Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for LIF active protein
Relevance: Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Human and murine mature LIF exhibit a 78% sequence identity at the amino acid level. Human LIF is equally active on human and mouse cells. Murine LIF is approximately 1000 fold less active on human cells than human LIF.

Function: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Product Categories/Family for LIF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.7 kDa
NCBI Official Full Name
leukemia inhibitory factor isoform 1
NCBI Official Synonym Full Names
LIF interleukin 6 family cytokine
NCBI Official Symbol
LIF
NCBI Official Synonym Symbols
CDF; DIA; HILDA; MLPLI
NCBI Protein Information
leukemia inhibitory factor
UniProt Protein Name
Leukemia inhibitory factor
UniProt Gene Name
LIF
UniProt Synonym Gene Names
HILDA; LIF; D factor; MLPLI
UniProt Entry Name
LIF_HUMAN

NCBI Description

The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

LIF: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. Belongs to the LIF/OSM family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: growth factor activity; leukemia inhibitory factor receptor binding; cytokine activity; receptor binding

Biological Process: transcription from RNA polymerase II promoter; negative regulation of hormone secretion; multicellular organismal development; leukemia inhibitory factor signaling pathway; stem cell maintenance; tyrosine phosphorylation of Stat3 protein; decidualization; positive regulation of peptidyl-serine phosphorylation; positive regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of cell proliferation; positive regulation of tyrosine phosphorylation of Stat1 protein; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; negative regulation of meiosis; positive regulation of cell proliferation; neuron development; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of macrophage differentiation; muscle morphogenesis; alveolus development; embryo implantation; positive regulation of peptidyl-serine phosphorylation of STAT protein; positive regulation of astrocyte differentiation

Research Articles on LIF

Similar Products

Product Notes

The LIF lif (Catalog #AAA7114997) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-202aa; Full Length of Mature Protein. The amino acid sequence is listed below: SPLPITPVNA TCAIRHPCHN NLMNQIRSQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKAKL VELYRIVVYL GTSLGNITRD QKILNPSALS LHSKLNATAD ILRGLLSNVL CRLCSKYHVG HVDVTYGPDT SGKDVFQKKK LGCQLLGKYK QIIAVLAQAF. It is sometimes possible for the material contained within the vial of "Leukemia Inhibitory Factor (LIF), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.