Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: ACVR1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit ACVR1 Polyclonal Antibody | anti-ACVR1 antibody

ACVR1 antibody - N-terminal region

Gene Names
ACVR1; FOP; ALK2; SKR1; TSRI; ACTRI; ACVR1A; ACVRLK2
Reactivity
Cow, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACVR1; Polyclonal Antibody; ACVR1 antibody - N-terminal region; anti-ACVR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSP
Sequence Length
509
Applicable Applications for anti-ACVR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: ACVR1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: ACVR1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ACVR1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACVR1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ACVR1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACVR1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-ACVR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ACVR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-ACVR1 antibody
This is a rabbit polyclonal antibody against ACVR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Activin receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 is activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors.Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
90
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
activin receptor type-1
NCBI Official Synonym Full Names
activin A receptor type 1
NCBI Official Symbol
ACVR1
NCBI Official Synonym Symbols
FOP; ALK2; SKR1; TSRI; ACTRI; ACVR1A; ACVRLK2
NCBI Protein Information
activin receptor type-1
UniProt Protein Name
Activin receptor type-1
Protein Family
UniProt Gene Name
ACVR1
UniProt Synonym Gene Names
ACVRLK2; ACTR-I; ALK-2; SKR1; TSR-I
UniProt Entry Name
ACVR1_HUMAN

NCBI Description

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. [provided by RefSeq, Jul 2008]

Uniprot Description

ALK2: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin. May be involved for left-right pattern formation during embryogenesis. Interacts with FKBP1A. Interacts with FCHO1. Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.

Protein type: Membrane protein, integral; Kinase, protein; EC 2.7.11.30; Protein kinase, Ser/Thr (receptor); Protein kinase, TKL; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 2q23-q24

Cellular Component: apical part of cell; integral to plasma membrane; activin receptor complex

Molecular Function: protein homodimerization activity; metal ion binding; peptide hormone binding; transmembrane receptor protein serine/threonine kinase activity; protein kinase activity; protein serine/threonine kinase activity; protein binding; activin receptor activity, type I; transforming growth factor beta receptor activity, type I; transforming growth factor beta binding; activin binding; SMAD binding; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: pharyngeal system development; in utero embryonic development; positive regulation of transcription, DNA-dependent; peptidyl-threonine phosphorylation; activin receptor signaling pathway; gastrulation with mouth forming second; positive regulation of bone mineralization; protein amino acid phosphorylation; germ cell development; negative regulation of signal transduction; BMP signaling pathway; patterning of blood vessels; positive regulation of osteoblast differentiation; negative regulation of activin receptor signaling pathway; mesoderm formation; transforming growth factor beta receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; smooth muscle cell differentiation; regulation of skeletal muscle development; determination of left/right symmetry; regulation of ossification; neural crest cell migration; acute inflammatory response; urogenital system development; G1/S transition of mitotic cell cycle

Disease: Fibrodysplasia Ossificans Progressiva

Research Articles on ACVR1

Similar Products

Product Notes

The ACVR1 acvr1 (Catalog #AAA3207637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACVR1 antibody - N-terminal region reacts with Cow, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACVR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACVR1 acvr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGLSCGNEDH CEGQQCFSSL SINDGFHVYQ KGCFQVYEQG KMTCKTPPSP. It is sometimes possible for the material contained within the vial of "ACVR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.