Interleukin-6 (IL6) Active Protein | IL6 active protein

Recombinant Human Interleukin-6 (IL6), Partial

Cat. Num. AAA7115027

• Gene Names: IL6; CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-6 (IL6); Recombinant Human Interleukin-6 (IL6); Partial; Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2; IL6 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM HAc-NaAc, 150 mM NaCl, pH 5.0
• Sequence Positions: 29-212aa; Partial
• Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Sequence Length: 212

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 1 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-6 Superfamily
• Classification: Cytokine
• Subdivision: Interleukin
• Pathway: HIF-1 Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL6 active protein

Relevance: Cytokines of the IL6/GCSF/MGF family are glycoproteins of about 170 to 180 amino acid residues that contain four conserved cysteine residues involved in two disulfide bonds. They have a compact, globular fold (similar to other interleukins), stabilized by the 2 disulfide bonds. One half of the structure is dominated by a 4 alpha-helix bundle with a left-handed twist; the helices are anti-parallel, with 2 overhand connections, which fall into a 2-stranded anti-parallel beta-sheet. The fourth alpha helix is important to the biological activity of the molecule. Interleukin-6 (IL-6) is an important proinflammatory and immunoregulatory cytokine expressed by various cells. Interleukin-6 has been shown to inhibit the growth of early stage and to promote the proliferation of advanced stage melanoma cells in vitro.

Function: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.

Product Categories/Family for IL6 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 124347
• NCBI GeneID: 3569
• UniProt Accession #: P05231
• Molecular Weight: 20.9 kDa
• NCBI Official Full Name: Interleukin-6
• NCBI Official Synonym Full Names: interleukin 6
• NCBI Official Symbol: IL6
• NCBI Official Synonym Symbols: CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
• NCBI Protein Information: interleukin-6
• UniProt Protein Name: Interleukin-6
• Protein Family: Interleukin
• UniProt Gene Name: IL6
• UniProt Synonym Gene Names: IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
• UniProt Entry Name: IL6_HUMAN

NCBI Description

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]