Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-1 Receptor Antagonist (IL1RN) Active Protein | IL1RN active protein

Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN)

Gene Names
IL1RN; DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-1 Receptor Antagonist (IL1RN); Recombinant Human Interleukin-1 Receptor Antagonist Protein (IL1RN); Interleukin-1 Receptor Antagonist Protein; IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 Inhibitor; Anakinra; IL1RN; IL1F3; IL1RA; IL1RN active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
The intracellular form of IL1RN is predominantly expressed in epithelial cells.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 7.5
Sequence Positions
26-177aa; Full Length of Mature Protein
Sequence
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Sequence Length
143
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the dose-dependent inhibition of IL-1 stimulation of D10S cells is typically 0.5 ng/mL.
Subcellular Location
Isoform 1: Secreted, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm
Classification
Cytokine
Subdivision
Interleukin
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL1RN active protein
Relevance: Interleukin-1 Receptor Antagonist (IL-1RN) is a member of the IL-1 family. Endogenous IL-1RN is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL-1RN. The regulated expression of IL-1RN in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts, IL-1, TNF-alpha, or PDGF markedly enhances the synthesis of IL-1RN.

Function: Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
Product Categories/Family for IL1RN active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17.26 kDa
NCBI Official Full Name
interleukin-1 receptor antagonist protein isoform 4
NCBI Official Synonym Full Names
interleukin 1 receptor antagonist
NCBI Official Symbol
IL1RN
NCBI Official Synonym Symbols
DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
NCBI Protein Information
interleukin-1 receptor antagonist protein
UniProt Protein Name
Interleukin-1 receptor antagonist protein
UniProt Gene Name
IL1RN
UniProt Synonym Gene Names
IL1F3; IL1RA; IL-1RN; IL-1ra; IRAP
UniProt Entry Name
IL1RA_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jan 2016]

Uniprot Description

IL1RN: Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure. The intracellular form of IL1RN is predominantly expressed in epithelial cells. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine; Secreted; Secreted, signal peptide; Vesicle

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: extracellular space; cytoplasm; plasma membrane; intracellular

Molecular Function: interleukin-1 Type I receptor antagonist activity; interleukin-1 receptor binding; interleukin-1 Type II receptor antagonist activity; interleukin-1, Type II receptor binding; cytokine activity; interleukin-1, Type I receptor binding; interleukin-1 receptor antagonist activity

Biological Process: response to drug; positive regulation of JNK activity; negative regulation of glutamate secretion; negative regulation of heterotypic cell-cell adhesion; response to glucocorticoid stimulus; carboxylic acid metabolic process; response to lipopolysaccharide; female pregnancy; sensory perception of pain; fever; chronic inflammatory response to antigenic stimulus; memory; response to starvation; insulin secretion; acute-phase response; negative regulation of cytokine and chemokine mediated signaling pathway; immune response; response to activity; lipid metabolic process; negative regulation of membrane potential; negative regulation of cell migration; negative regulation of apoptosis

Disease: Microvascular Complications Of Diabetes, Susceptibility To, 4; Gastric Cancer, Hereditary Diffuse; Osteomyelitis, Sterile Multifocal, With Periostitis And Pustulosis

Research Articles on IL1RN

Similar Products

Product Notes

The IL1RN il1rn (Catalog #AAA7115057) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-177aa; Full Length of Mature Protein. The amino acid sequence is listed below: RPSGRKSSKM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNV NLEEKIDVVP IEPHALFLGI HGGKMCLSCV KSGDETRLQL EAVNITDLSE NRKQDKRFAF IRSDSGPTTS FESAACPGWF LCTAMEADQP VSLTNMPDEG VMVTKFYFQE DE. It is sometimes possible for the material contained within the vial of "Interleukin-1 Receptor Antagonist (IL1RN), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.