Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Insulin-Like Growth Factor I (IGF1) Active Protein | IGF1 active protein

Recombinant Human Insulin-Like Growth Factor I (IGF1), Partial

Gene Names
IGF1; IGF; MGF; IGFI; IGF-I
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Insulin-Like Growth Factor I (IGF1); Recombinant Human Insulin-Like Growth Factor I (IGF1); Partial; Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1; IGF1 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM NaAc-HAC, pH 4.5
Sequence Positions
52-118aa; Partial
Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Sequence Length
195
Species
Human
Tag
Tag-Free
Endotoxin
Less than 0.5 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF-7 human breast cancer cells is typically 1-8 ng/mL
Subcellular Location
Secreted
Protein Families
Insulin Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
HIF-1 Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IGF1 active protein
Relevance: Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.

Function: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.
Product Categories/Family for IGF1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7.3 kDa
NCBI Official Full Name
insulin-like growth factor I isoform 3 preproprotein
NCBI Official Synonym Full Names
insulin like growth factor 1
NCBI Official Symbol
IGF1
NCBI Official Synonym Symbols
IGF; MGF; IGFI; IGF-I
NCBI Protein Information
insulin-like growth factor I
UniProt Protein Name
Insulin-like growth factor I
UniProt Gene Name
IGF1
UniProt Synonym Gene Names
IBP1; IGF-I; MGF
UniProt Entry Name
IGF1_HUMAN

NCBI Description

The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]

Uniprot Description

IGF1: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency). IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation. Belongs to the insulin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 12q23.2

Cellular Component: insulin-like growth factor binding protein complex; extracellular space; plasma membrane; extracellular region

Molecular Function: integrin binding; insulin-like growth factor receptor binding; protein binding; growth factor activity; hormone activity; insulin receptor binding

Biological Process: muscle development; positive regulation of transcription, DNA-dependent; chondroitin sulfate proteoglycan biosynthetic process; glycolate metabolic process; exocrine pancreas development; water homeostasis; positive regulation of glucose import; positive regulation of fibroblast proliferation; proteoglycan biosynthetic process; inner ear development; positive regulation of DNA binding; muscle hypertrophy; platelet activation; positive regulation of mitosis; positive regulation of protein import into nucleus, translocation; regulation of establishment and/or maintenance of cell polarity; positive regulation of phosphoinositide 3-kinase cascade; cell activation; positive regulation of peptidyl-tyrosine phosphorylation; branching morphogenesis of a tube; insulin-like growth factor receptor signaling pathway; regulation of gene expression; response to heat; positive regulation of transcription from RNA polymerase II promoter; alveolus development; positive regulation of epithelial cell proliferation; negative regulation of apoptosis; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of smooth muscle cell proliferation; myoblast proliferation; positive regulation of glycogen biosynthetic process; positive regulation of activated T cell proliferation; positive regulation of smooth muscle cell migration; signal transduction; negative regulation of cell proliferation; glial cell differentiation; platelet degranulation; positive regulation of MAPKKK cascade; mammary gland development; positive regulation of cell proliferation; DNA replication; skeletal development; positive regulation of granule cell precursor proliferation; phosphoinositide-mediated signaling; multicellular organism growth; regulation of multicellular organism growth; myotube cell development; satellite cell compartment self-renewal involved in skeletal muscle regeneration; myoblast differentiation; positive regulation of osteoblast differentiation; cell proliferation; positive regulation of protein kinase B signaling cascade; cellular protein metabolic process; positive regulation of tyrosine phosphorylation of Stat5 protein; positive regulation of glycolysis; Ras protein signal transduction; blood vessel remodeling; positive regulation of Ras protein signal transduction; blood coagulation; cell motility; positive regulation of DNA replication

Disease: Insulin-like Growth Factor I Deficiency

Research Articles on IGF1

Similar Products

Product Notes

The IGF1 igf1 (Catalog #AAA7114969) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-118aa; Partial. The amino acid sequence is listed below: TLCGAELVDA LQFVCGDRGF YFNKPTGYGS SSRRAPQTGI VDECCFRSCD LRRLEMYCAP LKPAKSA. It is sometimes possible for the material contained within the vial of "Insulin-Like Growth Factor I (IGF1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.