IL-33 active protein

Recombinant Human IL-33 Protein

Cat. Num. AAA9139622

• Gene Names: IL33; DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26
• Purity: >97% by SDS-PAGE.
• Synonyms: IL-33; Recombinant Human IL-33 Protein; C9orf26; DVS27; IL1F11; NF-HEV; NFEHEV; IL-33 active protein

• Host: E Coli
• Purity/Purification: >97% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
• Sequence Length: 144

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 0.06-0.24 ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: No tag
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-33 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 19 kDa.)

Related Product Information for IL-33 active protein

Description: Recombinant Human IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser112-Thr270) of human IL-33 (Accession #NP_001300973.1).

Background: Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial enules), is a proinflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells.

Product Categories/Family for IL-33 active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 314122337
• NCBI GeneID: 90865
• NCBI Accession #: NP_001186570.1
• NCBI GenBank Nucleotide #: NP_001186570.1
• UniProt Accession #: O95760
• NCBI Official Full Name: interleukin-33 isoform c
• NCBI Official Synonym Full Names: interleukin 33
• NCBI Official Symbol: IL33
• NCBI Official Synonym Symbols: DVS27; IL1F11; NF-HEV; NFEHEV; C9orf26
• NCBI Protein Information: interleukin-33
• UniProt Protein Name: Interleukin-33
• UniProt Gene Name: IL33
• UniProt Synonym Gene Names: C9orf26; IL1F11; NFHEV; IL-33; IL-1F11; NF-HEV
• UniProt Entry Name: IL33_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that binds to the IL1RL1/ST2 receptor. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

IL33: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Induces T-helper type 2-associated cytokines. Belongs to the IL-1 family. Highly divergent. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 9p24.1

Cellular Component: extracellular space; transport vesicle; chromosome; nucleus

Molecular Function: protein binding; cytokine activity

Biological Process: negative regulation of T-helper 1 type immune response; T-helper 2 type immune response; positive regulation of T-helper 2 type immune response; transcription, DNA-dependent; positive regulation of interleukin-6 production; positive regulation of immunoglobulin secretion; negative regulation of leukocyte migration; positive regulation of interleukin-4 production; negative regulation of immunoglobulin secretion; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; negative regulation of interferon-gamma production; positive regulation of transcription from RNA polymerase II promoter; positive regulation of interleukin-13 production; positive regulation of interleukin-5 production; positive regulation of inflammatory response; positive regulation of macrophage activation