IGF-BP3 active protein

Recombinant Human IGF-BP3 (rHu IGF-BP3)

Cat. Num. AAA546162

• Gene Names: Igfbp3; IGF-BP3
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Synonyms: IGF-BP3; Recombinant Human IGF-BP3 (rHu IGF-BP3); human IGF-BP3; Human Insulin-like Growth Factor-Binding Protein 3(rHuIGF-BP3); IGF-BP3 active protein

• Host: E Coli
• Purity/Purification: >98% by SDS-PAGE and HPLC analyses.
• Form/Format: Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
• Sequence: GASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPA PPAPGNASESEEDRSAGEVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYS MQSK
• Sequence Length: 292

• Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Endotoxin Level: Less than 1EU/ug of rHuIGF-BP3 as determined by LAL method.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions.
• Biological Activity: The ED₅₀ was determined by its ability to inhibit IGF-II induced proliferation of MCF-7. The expected ED₅₀ for this effect is < 0.2 ug/ml in presence of 15 ng/ml of human IGF-II.
• Preparation and Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Related Product Information for IGF-BP3 active protein

IGF-BP3 is a 30 kDa cysteine-rich secreted protein. It is the major IGF binding protein present in the plasma of human and animals and it is also found in á-granules of platelets. In addition to its ability to modulate the activity of IGF-I and IGF-II, IGF-BP3 exerts inhibitory effects on follicle stimulating hormone (FSH) activity. Decreased plasma levels of IGF-BP3 often results in dwarfism, whereas elevated levels of IGF-BP3 may lead to acromegaly. The expression of IGF-BP3 in fibroblasts is stimulated by mitogenic growth factors such as Bombesin, Vasopressin, PDGF, and EGF.

NCBI and Uniprot Product Information

• NCBI GI #: 298231182
• NCBI GeneID: 24484
• NCBI Accession #: NP_036720.2
• NCBI GenBank Nucleotide #: NM_012588.2
• UniProt Accession #: P15473
• Molecular Weight: 28.8 kDa protein consisting of 264 amino acids residues.
• NCBI Official Full Name: insulin-like growth factor-binding protein 3
• NCBI Official Synonym Full Names: insulin-like growth factor binding protein 3
• NCBI Official Symbol: Igfbp3
• NCBI Official Synonym Symbols: IGF-BP3
• NCBI Protein Information: insulin-like growth factor-binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; insulin-like growth factor-binding protein (IGF-BP3)
• UniProt Protein Name: Insulin-like growth factor-binding protein 3
• UniProt Gene Name: Igfbp3
• UniProt Synonym Gene Names: Igfbp-3; IBP-3; IGF-binding protein 3; IGFBP-3
• UniProt Entry Name: IBP3_RAT

NCBI Description

an insulin growth factor (Igf) binding protein; involved in modulating IGF-I action [RGD, Feb 2006]

Uniprot Description

IGFBP3: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R.

Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation

Cellular Component: extracellular space; nucleus

Molecular Function: insulin-like growth factor binding; protein binding; insulin-like growth factor I binding; fibronectin binding; insulin-like growth factor II binding; protein tyrosine phosphatase activator activity

Biological Process: positive regulation of catalytic activity; positive regulation of insulin-like growth factor receptor signaling pathway; osteoblast differentiation; negative regulation of cell proliferation; regulation of insulin-like growth factor receptor signaling pathway; negative regulation of protein amino acid phosphorylation; positive regulation of MAPKKK cascade; negative regulation of smooth muscle cell proliferation; positive regulation of apoptosis; regulation of growth; negative regulation of smooth muscle cell migration; regulation of cell growth; protein amino acid phosphorylation; positive regulation of myoblast differentiation