Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fibroblast Growth Factor 2 (FGF2) Active Protein | FGF2 active protein

Recombinant Human Fibroblast Growth Factor 2 (FGF2), Partial

Gene Names
FGF2; BFGF; FGFB; FGF-2; HBGF-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fibroblast Growth Factor 2 (FGF2); Recombinant Human Fibroblast Growth Factor 2 (FGF2); Partial; Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB; FGF2 active protein
Ordering
For Research Use Only!
Host
E Coli
Specificity
Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Sequence Positions
132-288aa; Partial
Sequence
GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Sequence Length
146
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.
Subcellular Location
Secreted, Nucleus
Protein Families
Heparin-Binding Growth Factors Family
Classification
Cytokine
Subdivision
Growth Factor
Pathway
MAPK Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for FGF2 active protein
Relevance: FGF-basic is a members of the Fibroblast Growth Factors (FGFs) family. The family constitutes a large family of proteins involved in many aspects of development including cell proliferation, growth, and differentiation. They act on several cell types to regulate diverse physiologic functions including angiogenesis, cell growth, pattern formation, embryonic development, metabolic regulation, cell migration, neurotrophic effects, and tissue repair. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4.

Function: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.
Product Categories/Family for FGF2 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
17.4 kDa
NCBI Official Full Name
basic fibroblast growth factor, partial
NCBI Official Synonym Full Names
fibroblast growth factor 2
NCBI Official Symbol
FGF2
NCBI Official Synonym Symbols
BFGF; FGFB; FGF-2; HBGF-2
NCBI Protein Information
fibroblast growth factor 2
UniProt Protein Name
Fibroblast growth factor 2
Protein Family
UniProt Gene Name
FGF2
UniProt Synonym Gene Names
FGFB; FGF-2; bFGF; HBGF-2
UniProt Entry Name
FGF2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF2: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Monomer. Homodimer. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. Interacts with CSPG4, FGFBP1 and TEC. Found in a complex with FGFBP1, FGF1 and FGF2. Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non- cancerous liver tissue. Belongs to the heparin-binding growth factors family. 4 isoforms of the human protein are produced by alternative initiation.

Protein type: Activator; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4q26

Cellular Component: extracellular space; extracellular region; nucleus

Molecular Function: heparin binding; protein binding; growth factor activity; ligand-dependent nuclear receptor transcription coactivator activity; cytokine activity; chemoattractant activity; fibroblast growth factor receptor binding

Biological Process: extracellular matrix organization and biogenesis; wound healing; nerve growth factor receptor signaling pathway; somatic stem cell maintenance; activation of MAPK activity; positive regulation of transcription, DNA-dependent; signal transduction; chemotaxis; hyaluronan catabolic process; growth factor dependent regulation of satellite cell proliferation; positive regulation of MAP kinase activity; positive chemotaxis; positive regulation of cell proliferation; embryonic morphogenesis; positive regulation of cardiac muscle cell proliferation; epidermal growth factor receptor signaling pathway; nervous system development; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; positive regulation of cell fate specification; positive regulation of blood vessel endothelial cell migration; positive regulation of phosphoinositide 3-kinase activity; negative regulation of blood vessel endothelial cell migration; regulation of angiogenesis; organ morphogenesis; positive regulation of angiogenesis; cell migration during sprouting angiogenesis; ureteric bud branching; positive regulation of cell division; release of sequestered calcium ion into cytosol; Ras protein signal transduction; insulin receptor signaling pathway; phosphatidylinositol biosynthetic process; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; inositol phosphate biosynthetic process

Research Articles on FGF2

Similar Products

Product Notes

The FGF2 fgf2 (Catalog #AAA7114972) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 132-288aa; Partial. The amino acid sequence is listed below: GTMAAGSITT LPALPEDGGS GAFPPGHFKD PKRLYCKNGG FFLRIHPDGR VDGVREKSDP HIKLQLQAEE RGVVSIKGVC ANRYLAMKED GRLLASKCVT DECFFFERLE SNNYNTYRSR KYTSWYVALK RTGQYKLGSK TGPGQKAILF LPMSAKS. It is sometimes possible for the material contained within the vial of "Fibroblast Growth Factor 2 (FGF2), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.