Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Epidermal Growth Factor Active Protein | EGF active protein

Epidermal Growth Factor, Recombinant, Human (E. coli) (EGF)

Gene Names
EGF; URG; HOMG4
Purity
Highly Purified
98% ([SDS-PAGE and HPLC)
Synonyms
Epidermal Growth Factor; Recombinant; Human (E. coli) (EGF); EGF active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Highly Purified
98% ([SDS-PAGE and HPLC)
Form/Format
Supplied as a lyophillized powder. Reconstitute with sterile ddH2O, 0.1% HSA or BSA to 100ug/ml, which can then be further diluted to other aqueous solutions.
Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Biological Activity
ED50 calculated by the dose-dependent proliferation of murine BALB/c 3T3 cells (measured by 3H-thymidine uptake) is <0.1ng/ml corresponding to a specific activity of 1x10e7units/mg.
Protein Content
EGF quantitation was carried out by two independent methods:
1. UV spectroscopy at 280nm using the absorbency value of 2.858 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a calibrated solution of EGF as a Reference Standard.
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Reconstitute with sterile ddH2O, 0.1% HSA or BSA. Aliquot and store at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Related Product Information for EGF active protein
Epidermal Growth Factor (EGF) is a polypeptide growth factor which stimulates the proliferation of a wide range of epidermal and epithelial cells. Human EGF is a 6.2kD protein containing 53 amino acid residues.
Product Categories/Family for EGF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
6.2kD
NCBI Official Full Name
epidermal growth factor
NCBI Official Synonym Full Names
epidermal growth factor
NCBI Official Symbol
EGF
NCBI Official Synonym Symbols
URG; HOMG4
NCBI Protein Information
pro-epidermal growth factor; beta-urogastrone; OTTHUMP00000162922; OTTHUMP00000219721; OTTHUMP00000219722
UniProt Protein Name
Epidermal growth factor
Protein Family
UniProt Gene Name
EGF
UniProt Entry Name
Q6QBS2_HUMAN

NCBI Description

This gene encodes a member of the epidermal growth factor superfamily. The encoded protein is synthesized as a large precursor molecule that is proteolytically cleaved to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding the high affinity cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternate splicing results in multiple transcript variants.

Research Articles on EGF

Similar Products

Product Notes

The EGF egf (Catalog #AAA650926) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: NSDSECPLSH DGYCLHDGVC MYIEALDKYA CNCVVGYIGE RCQYRDLKWW ELR. It is sometimes possible for the material contained within the vial of "Epidermal Growth Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.