CCL14 (HCC-1) Active Protein | CCL14 active protein

Recombinant CCL14 (HCC-1), biotinylated

Cat. Num. AAA191501

• Gene Names: CCL14; CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3
• Purity: >97% by SDS-PAGE
• Synonyms: CCL14 (HCC-1); Recombinant CCL14 (HCC-1); biotinylated; Human CCL14; CCL14 active protein

• Host: E Coli
• Purity/Purification: >97% by SDS-PAGE
• Form/Format: Lyophilized
• Sequence: GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC TNPSDKWVQDYIKDMKEN
• Sequence Length: 109

• Source: Human
• Endotoxin: <0.01 EU per 1ug of protein by LAL method.
• Activity: EC50 = 0.2-0.4nM determined by Migration Assay in cells expressing CCR1.
• Modification: Biotinylated
• Reconstitution: Recommended at 100ug/ml in sterile distilled water.
• Carrier Protein: None
• Preparation and Storage: 12 months from date of receipt,-20 degree C to-70 degree C, as supplied.; 1 month,-20 degree C to-70 degree C, under sterile conditions after reconstitution.; Best if used immediately after reconstitution.

Related Product Information for CCL14 active protein

CCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of fulllength HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.

NCBI and Uniprot Product Information

• NCBI GI #: 14589959
• NCBI GeneID: 6358
• NCBI Accession #: NP_116738.1
• NCBI GenBank Nucleotide #: NM_032962.4
• UniProt Accession #: Q16627; Q13954; E1P649; E1P650
• Molecular Weight: 10.22kDa by Mass Spec.
• NCBI Official Full Name: C-C motif chemokine 14 isoform 2
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 14
• NCBI Official Symbol: CCL14
• NCBI Official Synonym Symbols: CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3
• NCBI Protein Information: C-C motif chemokine 14
• UniProt Protein Name: C-C motif chemokine 14
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL14
• UniProt Synonym Gene Names: NCC2; SCYA14; HCC-1/HCC-3

NCBI Description

This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009]

Uniprot Description

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca2+ changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.