Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CCL14 (HCC-1) Active Protein | CCL14 active protein

Recombinant CCL14 (HCC-1)

Gene Names
CCL14; CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3
Purity
>97% by SDS-PAGE
Synonyms
CCL14 (HCC-1); Recombinant CCL14 (HCC-1); Human CCL14; CCL14 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>97% by SDS-PAGE
Form/Format
Lyophilized
Sequence
GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC TNPSDKWVQDYIKDMKEN
Sequence Length
109
Source
Human
Endotoxin
<0.01 EU per 1ug of protein by LAL method.
Activity
EC50 = 0.1-0.4nM determined by Migration Assay in cells expressing CCR1.
Reconstitution
Recommended at 100ug/ml in sterile distilled water.
Carrier Protein
None
Preparation and Storage
12 months from date of receipt,-20 degree C to-70 degree C, as supplied.
1 month,-20 degree C to-70 degree C, under sterile conditions after reconstitution.
Best if used immediately after reconstitution.
Related Product Information for CCL14 active protein
CCL14, also known as Hemofiltrate CC Chemokine-1 (HCC-1) is a small cytokine (~8kDa) that is constitutively expressed in multiple tissues. Upon processing of the N-terminal residues of full-length HCC-1 by the uPA-plasmin system, the active form of HCC-1 is a strong agonist for CCR1, CCR5, and, to a lesser extent, CCR3. CCL14 causes chemotaxis of different types of leukocytes, and its active form is a potent inhibitor of HIV entry.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7.801kDa by Mass Spec.
NCBI Official Full Name
C-C motif chemokine 14 isoform 2
NCBI Official Synonym Full Names
C-C motif chemokine ligand 14
NCBI Official Symbol
CCL14
NCBI Official Synonym Symbols
CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3
NCBI Protein Information
C-C motif chemokine 14
UniProt Protein Name
C-C motif chemokine 14
Protein Family
UniProt Gene Name
CCL14
UniProt Synonym Gene Names
NCC2; SCYA14; HCC-1/HCC-3

NCBI Description

This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009]

Uniprot Description

Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca2+ changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5.

Research Articles on CCL14

Similar Products

Product Notes

The CCL14 ccl14 (Catalog #AAA191500) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GPYHPSECCF TYTTYKIPRQ RIMDYYETNS QCSKPGIVFI TKRGHSVC TNPSDKWVQD YIKDMKEN. It is sometimes possible for the material contained within the vial of "CCL14 (HCC-1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.