Carbonic Anhydrase 13 (CA13) Active Protein | CA13 active protein
Recombinant Human Carbonic Anhydrase 13 (CA13)
Gene Names
CA13; CAXIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic Anhydrase 13 (CA13); Recombinant Human Carbonic Anhydrase 13 (CA13); Carbonic Anhydrase 13; Carbonate Dehydratase XIII; Carbonic Anhydrase XIII; CA-XIII; CA13; CA13 active protein
Host
E Coli
Specificity
Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Sequence Positions
1-262aa; Full Length
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Sequence Length
262
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 1000 pmol/min/ug
Protein Families
Alpha-Carbonic Anhydrase Family
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CA13 active protein
Relevance: Carbonic Anhydrase 13 (CA13) belongs to the carbonic anhydrase family which can catalyzes the reversible hydration recation of carbon dioxide. Carbonic anhydrases participate in many biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA13 is a cytosolic enzyme and is widely expressed in human, such as thymus, small intestine, spleen, prostate, ovary, colon and testis, indicating that it may play a key role in several organs. CA13 is inhibited by acetazolamide.
Function: Reversible hydration of carbon dioxide.
Function: Reversible hydration of carbon dioxide.
Product Categories/Family for CA13 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.51 kDa
NCBI Official Full Name
carbonic anhydrase 13
NCBI Official Synonym Full Names
carbonic anhydrase 13
NCBI Official Symbol
CA13
NCBI Official Synonym Symbols
CAXIII
NCBI Protein Information
carbonic anhydrase 13
UniProt Protein Name
Carbonic anhydrase 13
Protein Family
UniProt Gene Name
CA13
UniProt Synonym Gene Names
CA-XIII
UniProt Entry Name
CAH13_HUMAN
NCBI Description
Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008]
Uniprot Description
CA13: Reversible hydration of carbon dioxide. Belongs to the alpha-carbonic anhydrase family.
Protein type: Energy Metabolism - nitrogen; EC 4.2.1.1; Lyase
Chromosomal Location of Human Ortholog: 8q21.2
Cellular Component: cytosol; myelin sheath
Molecular Function: carbonate dehydratase activity; zinc ion binding
Biological Process: bicarbonate transport; one-carbon compound metabolic process
Research Articles on CA13
Similar Products
Product Notes
The CA13 ca13 (Catalog #AAA7115137) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-262aa; Full Length. The amino acid sequence is listed below: MSRLSWGYRE HNGPIHWKEF FPIADGDQQS PIEIKTKEVK YDSSLRPLSI KYDPSSAKII SNSGHSFNVD FDDTENKSVL RGGPLTGSYR LRQVHLHWGS ADDHGSEHIV DGVSYAAELH VVHWNSDKYP SFVEAAHEPD GLAVLGVFLQ IGEPNSQLQK ITDTLDSIKE KGKQTRFTNF DLLSLLPPSW DYWTYPGSLT VPPLLESVTW IVLKQPINIS SQQLAKFRSL LCTAEGEAAA FLVSNHRPPQ PLKGRKVRAS FH. It is sometimes possible for the material contained within the vial of "Carbonic Anhydrase 13 (CA13), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
