C-X-C Motif Chemokine 3 (CXCL3) Active Protein | CXCL3 active protein
Recombinant Human C-X-C Motif Chemokine 3 (CXCL3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C Motif Chemokine 3 (CXCL3); Recombinant Human C-X-C Motif Chemokine 3 (CXCL3); C-X-C Motif Chemokine 3; GRO-Gamma (1-73); Growth-Regulated Protein Gamma; GRO-Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2-Beta; GRO-Gamma (5-73); CXCL3; GRO3; GROG; SCYB3; CXCL3 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
35-107aa; Full Length of Mature Protein
Sequence
ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Sequence Length
103
Species
Human
Tag
N-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is typically 80 ng/mL.
Subcellular Location
Secreted
Protein Families
Intercrine alpha (chemokine CxC) Family
Classification
Cytokine
Subdivision
Chemokine
Pathway
Chemokine Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CXCL3 active protein
Relevance: C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Function: Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
Function: Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.
Product Categories/Family for CXCL3 active protein
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
10.1 kDa
NCBI Official Full Name
Macrophage inflammatory protein 2-beta
UniProt Protein Name
C-X-C motif chemokine 3
Protein Family
UniProt Gene Name
CXCL3
UniProt Synonym Gene Names
GRO3; GROG; SCYB3; GRO-gamma; MIP2-beta
UniProt Entry Name
CXCL3_HUMAN
Uniprot Description
CXCL3: Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. Belongs to the intercrine alpha (chemokine CxC) family.
Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 4q21
Cellular Component: extracellular space; extracellular region
Molecular Function: chemokine activity; CXCR chemokine receptor binding
Biological Process: G-protein coupled receptor protein signaling pathway; neutrophil chemotaxis; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; immune response; inflammatory response; regulation of cell proliferation
Similar Products
Product Notes
The CXCL3 cxcl3 (Catalog #AAA7114952) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-107aa; Full Length of Mature Protein. The amino acid sequence is listed below: ASVVTELRCQ CLQTLQGIHL KNIQSVNVRS PGPHCAQTEV IATLKNGKKA CLNPASPMVQ KIIEKILNKG STN. It is sometimes possible for the material contained within the vial of "C-X-C Motif Chemokine 3 (CXCL3), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
