Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

C-Type Lectin Domain Family 4 Member C (CLEC4C) Active Protein | CLEC4C active protein

Recombinant Human C-Type Lectin Domain Family 4 Member C (CLEC4C), Parial (Active)

Gene Names
CLEC4C; DLEC; HECL; BDCA2; CD303; BDCA-2; CLECSF7; CLECSF11; PRO34150
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-Type Lectin Domain Family 4 Member C (CLEC4C); Recombinant Human C-Type Lectin Domain Family 4 Member C (CLEC4C); Parial (Active); Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7 Dendritic lectin; CD303; CLEC4C active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0
Sequence Positions
45-213aa; Extracellular Domain
Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Sequence Length
182
Species
Human
Tag
N-terminal 6xHis-SUMO-tagged
Endotoxin
Not test.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 ug/ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 ug/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for CLEC4C active protein
Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.
Product Categories/Family for CLEC4C active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
C-type lectin domain family 4 member C isoform 2
NCBI Official Synonym Full Names
C-type lectin domain family 4 member C
NCBI Official Symbol
CLEC4C
NCBI Official Synonym Symbols
DLEC; HECL; BDCA2; CD303; BDCA-2; CLECSF7; CLECSF11; PRO34150
NCBI Protein Information
C-type lectin domain family 4 member C
UniProt Protein Name
C-type lectin domain family 4 member C
UniProt Gene Name
CLEC4C
UniProt Synonym Gene Names
BDCA2; CLECSF11; CLECSF7; DLEC; HECL; BDCA-2
UniProt Entry Name
CLC4C_HUMAN

NCBI Description

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CLEC4C: Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein- tyrosine kinases and mobilizes intracellular calcium. Does not seem to bind mannose. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 12p13.2-p12.3

Cellular Component: integral to membrane

Molecular Function: carbohydrate binding

Biological Process: innate immune response

Research Articles on CLEC4C

Similar Products

Product Notes

The CLEC4C clec4c (Catalog #AAA7135725) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-213aa; Extracellular Domain. The amino acid sequence is listed below: NFMYSKTVKR LSKLREYQQY HPSLTCVMEG KDIEDWSCCP TPWTSFQSSC YFISTGMQSW TKSQKNCSVM GADLVVINTR EEQDFIIQNL KRNSSYFLGL SDPGGRRHWQ WVDQTPYNEN VTFWHSGEPN NLDERCAIIN FRSSEEWGWN DIHCHVPQKS ICKMKKIYI. It is sometimes possible for the material contained within the vial of "C-Type Lectin Domain Family 4 Member C (CLEC4C), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.