Beta-Nerve Growth Factor (Ngf) Active Protein | Ngf active protein

Recombinant Mouse Beta-Nerve Growth Factor (Ngf), Partial

Cat. Num. AAA7115005

• Gene Names: Ngf; Ngfb; beta-NGF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Beta-Nerve Growth Factor (Ngf); Recombinant Mouse Beta-Nerve Growth Factor (Ngf); Partial; Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB; Ngf active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0
• Sequence Positions: 130-239aa; Partial
• Sequence: MGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATR
• Sequence Length: 241

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 5 ng/ml.
• Subcellular Location: Secreted
• Protein Families: NGF-beta Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Ngf active protein

Relevance: NGF is the first member discovered in the Neurotrophin family, which includes brain-derived neurotrophic factor (BDNF), neurotrophin-3 (NT-3), and neurotrophin-4 (NT-4). These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Mouse beta -NGF is a homodimer of two 120 amino acid polypeptides. It shares approximately 90% homology at the amino acid level with human beta -NGF and 95. 8% with rat beta -NGF. NGF signaling has been shown to play an important role in neuroprotection and repair. beta-NGF acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival. It is a potent neurotrophic factor that signals through its receptor beta-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems.

Function: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Product Categories/Family for Ngf active protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 162951831
• NCBI GeneID: 18049
• NCBI Accession #: NP_001106168.1
• NCBI GenBank Nucleotide #: NM_001112698.2
• UniProt Accession #: P01139
• Molecular Weight: 12.4 kDa
• NCBI Official Full Name: beta-nerve growth factor isoform B
• NCBI Official Synonym Full Names: nerve growth factor
• NCBI Official Symbol: Ngf
• NCBI Official Synonym Symbols: Ngfb; beta-NGF
• NCBI Protein Information: beta-nerve growth factor
• UniProt Protein Name: Beta-nerve growth factor
• Protein Family: Beta-nerve growth factor
• UniProt Gene Name: Ngf
• UniProt Synonym Gene Names: Ngfb; Beta-NGF
• UniProt Entry Name: NGF_MOUSE

Uniprot Description

NGF: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Homodimer. Belongs to the NGF-beta family.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: extracellular space; cytoplasmic membrane-bound vesicle; extracellular region

Molecular Function: metalloendopeptidase inhibitor activity; nerve growth factor receptor binding; growth factor activity; receptor signaling protein activity; receptor binding

Biological Process: positive regulation of neuron maturation; adult locomotory behavior; regulation of neuron differentiation; positive regulation of axon extension; regulation of neurotransmitter secretion; sensory perception of pain; positive regulation of cell growth; positive regulation of protein amino acid autophosphorylation; positive regulation of nerve growth factor receptor signaling pathway; regulation of release of sequestered calcium ion into cytosol; memory; peripheral nervous system development; neuron apoptosis; induction of apoptosis via death domain receptors; positive regulation of cell proliferation; positive regulation of transcription factor activity; negative regulation of neuron apoptosis; positive regulation of neuron differentiation; positive regulation of collateral sprouting; transmembrane receptor protein tyrosine kinase signaling pathway; neurite development; neurite morphogenesis