Probable deoxyhypusine synthase (dys) Recombinant Protein | dys recombinant protein
Recombinant Thermococcus onnurineus Probable deoxyhypusine synthase (dys)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable deoxyhypusine synthase (dys); Recombinant Thermococcus onnurineus Probable deoxyhypusine synthase (dys); dys recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-335, Full length protein
Sequence
MTEPKDIVLKESEEIEGTPIEGPWLDEVRILEEVIDYYHRIGFQATHLGRAIEIWKKVEEKRASGEEVRVFLGYTSNIVSSGLRELIAWLVKEGKVDVIVTTAGGVEEDFIKALKPFILGDWYVNDAEMREKGINRIGNIFVPNDRYIEFEKYMIPFFERVLEMEKERGKPLTASEFIYEMGRFMDEKLGKEKERSIIYWAYKRNVPIFCPAITDGSIGDMLYFFKEERGDRELIIDVANDIVKLNNLAVTAKETASIILGGSLPKHAIINANLFRGGTDYAIYVTTAIPWDGSLSGAPPSEGVSWGKIRAKADYVEIWADATLVFPVLVWKVMR
Sequence Length
335
Species
Thermococcus onnurineus (strain NA1)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,173 Da
NCBI Official Full Name
deoxyhypusine synthase
UniProt Protein Name
Probable deoxyhypusine synthase
Protein Family
UniProt Gene Name
dys
UniProt Synonym Gene Names
DHS
Uniprot Description
Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.
Similar Products
Product Notes
The dys dys (Catalog #AAA1034155) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-335, Full length protein. The amino acid sequence is listed below: MTEPKDIVLK ESEEIEGTPI EGPWLDEVRI LEEVIDYYHR IGFQATHLGR AIEIWKKVEE KRASGEEVRV FLGYTSNIVS SGLRELIAWL VKEGKVDVIV TTAGGVEEDF IKALKPFILG DWYVNDAEMR EKGINRIGNI FVPNDRYIEF EKYMIPFFER VLEMEKERGK PLTASEFIYE MGRFMDEKLG KEKERSIIYW AYKRNVPIFC PAITDGSIGD MLYFFKEERG DRELIIDVAN DIVKLNNLAV TAKETASIIL GGSLPKHAII NANLFRGGTD YAIYVTTAIP WDGSLSGAPP SEGVSWGKIR AKADYVEIWA DATLVFPVLV WKVMR. It is sometimes possible for the material contained within the vial of "Probable deoxyhypusine synthase (dys), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
