Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytoplasmic dynein 1 heavy chain 1 (Dync1h1) Recombinant Protein | Dync1h1 recombinant protein

Recombinant Mouse Cytoplasmic dynein 1 heavy chain 1 (Dync1h1) , partial

Gene Names
Dync1h1; Loa; P22; Swl; DHC1; DNCL; DHC1a; Dnec1; Dnecl; MAP1C; Dnchc1; AI894280; mKIAA0325; 9930018I23Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytoplasmic dynein 1 heavy chain 1 (Dync1h1); Recombinant Mouse Cytoplasmic dynein 1 heavy chain 1 (Dync1h1); partial; Dync1h1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
446-800, Partial, provide the Interaction with DYNC1I2 and DYNC1LI2 region
Sequence
MVWRINPAHRKLQARLDQMRKFRRQHEQLRAVIVRVLRPQVTAVAQQNQGEAPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGLDVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGRIFTIESARVRGRTGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYPFAISLIESVRTYERTCEKVEERNTIS
Sequence Length
800
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dync1h1 recombinant protein
Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
532,045 Da
NCBI Official Full Name
cytoplasmic dynein 1 heavy chain 1
NCBI Official Synonym Full Names
dynein cytoplasmic 1 heavy chain 1
NCBI Official Symbol
Dync1h1
NCBI Official Synonym Symbols
Loa; P22; Swl; DHC1; DNCL; DHC1a; Dnec1; Dnecl; MAP1C; Dnchc1; AI894280; mKIAA0325; 9930018I23Rik
NCBI Protein Information
cytoplasmic dynein 1 heavy chain 1
UniProt Protein Name
Cytoplasmic dynein 1 heavy chain 1
Protein Family
UniProt Gene Name
Dync1h1
UniProt Synonym Gene Names
Dhc1; Dnch1; Dnchc1; Dyhc

Uniprot Description

Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Plays a role in mitotic spindle assembly and metaphase plate congression.

Research Articles on Dync1h1

Similar Products

Product Notes

The Dync1h1 dync1h1 (Catalog #AAA1477926) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 446-800, Partial, provide the Interaction with DYNC1I2 and DYNC1LI2 region. The amino acid sequence is listed below: MVWRINPAHR KLQARLDQMR KFRRQHEQLR AVIVRVLRPQ VTAVAQQNQG EAPEPQDMKV AEVLFDAADA NAIEEVNLAY ENVKEVDGLD VSKEGTEAWE AAMKRYDERI DRVETRITAR LRDQLGTAKN ANEMFRIFSR FNALFVRPHI RGAIREYQTQ LIQRVKDDIE SLHDKFKVQY PQSQACKMSH VRDLPPVSGS IIWAKQIDRQ LTAYMKRVED VLGKGWENHV EGQKLKQDGD SFRMKLNTQE IFDDWARKVQ QRNLGVSGRI FTIESARVRG RTGNVLKLKV NFLPEIITLS KEVRNLKWLG FRVPLAIVNK AHQANQLYPF AISLIESVRT YERTCEKVEE RNTIS . It is sometimes possible for the material contained within the vial of "Cytoplasmic dynein 1 heavy chain 1 (Dync1h1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.