Dual specificity protein phosphatase 26 Recombinant Protein | DUSP26 recombinant protein

Recombinant Human Dual specificity protein phosphatase 26

Cat. Num. AAA1350791

• Gene Names: DUSP26; MKP8; NEAP; DSP-4; LDP-4; MKP-8; NATA1; SKRP3; DUSP24
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dual specificity protein phosphatase 26; Recombinant Human Dual specificity protein phosphatase 26; Dual specificity phosphatase SKRP3; Low-molecular-mass dual-specificity phosphatase 4; DSP-4; LDP-4; Mitogen-activated protein kinase phosphatase 8; MAP kinase phosphatase 8; MKP-8; Novel amplified gene in thyroid anaplastic cancer; DUSP26 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-211aa; Full Length
• Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
• Sequence Length: 211

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for DUSP26 recombinant protein

Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).

Product Categories/Family for DUSP26 recombinant protein

Signal Transduction

References

MKP-8, a novel MAPK phosphatase that inhibits p38 kinase.Vasudevan S.A., Skoko J., Wang K., Burlingame S.M., Patel P.N., Lazo J.S., Nuchtern J.G., Yang J.Biochem. Biophys. Res. Commun. 330:511-518(2005) A novel amplification target, DUSP26, promotes anaplastic thyroid cancer cell growth by inhibiting p38 MAPK activity.Yu W., Imoto I., Inoue J., Onda M., Emi M., Inazawa J.Oncogene 26:1178-1187(2007) Characterization of a novel low-molecular-mass dual specificity phosphatase-4 (LDP-4) expressed in brain.Takagaki K., Shima H., Tanuma N., Nomura M., Satoh T., Watanabe M., Kikuchi K.Mol. Cell. Biochem. 296:177-184(2007) Identification of a novel dual specificity phosphatase, SKRP3.Zama T., Aoki R., Murata M., Ikeda Y.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 760998197
• NCBI GeneID: 78986
• NCBI Accession #: NP_001292044.1
• NCBI GenBank Nucleotide #: NM_001305115.1
• UniProt Accession #: Q9BV47; Q9BTW0; D3DSV8
• Molecular Weight: 39.9 kDa
• NCBI Official Full Name: dual specificity protein phosphatase 26
• NCBI Official Synonym Full Names: dual specificity phosphatase 26 (putative)
• NCBI Official Symbol: DUSP26
• NCBI Official Synonym Symbols: MKP8; NEAP; DSP-4; LDP-4; MKP-8; NATA1; SKRP3; DUSP24
• NCBI Protein Information: dual specificity protein phosphatase 26
• UniProt Protein Name: Dual specificity protein phosphatase 26
• Protein Family: Dual specificity protein phosphatase
• UniProt Gene Name: DUSP26
• UniProt Synonym Gene Names: DUSP24; LDP4; MKP8; NATA1; SKRP3; DSP-4; LDP-4; MAP kinase phosphatase 8; MKP-8
• UniProt Entry Name: DUS26_HUMAN

NCBI Description

This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Uniprot Description

DUSP26: Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK). Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein phosphatase, dual-specificity; EC 3.1.3.48; Motility/polarity/chemotaxis; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: cytoplasm; Golgi apparatus; mitochondrion; nucleus

Molecular Function: p53 binding; phosphoprotein phosphatase activity; phosphoserine phosphatase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity

Biological Process: negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell adhesion; protein amino acid dephosphorylation