Dehydration-responsive element-binding protein 2G (DREB2G) Recombinant Protein | DREB2G recombinant protein
Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2G (DREB2G)
Gene Names
AT5G18450; F20L16.170; F20L16_170
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dehydration-responsive element-binding protein 2G (DREB2G); Recombinant Arabidopsis thaliana Dehydration-responsive element-binding protein 2G (DREB2G); DREB2G recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-307, Full length protein
Sequence
MEEEQPPAKKRNMGRSRKGCMKGKGGPENATCTFRGVRQRTWGKWVAEIREPNRGTRLWLGTFNTSVEAAMAYDEAAKKLYGHEAKLNLVHPQQQQQVVVNRNLSFSGHGSGSWAYNKKLDMVHGLDLGLGQASCSRGSCSERSSFLQEDDDHSHNRCSSSSGSNLCWLLPKQSDSQDQETVNATTSYGGEGGGGSTLTFSTNLKPKNLMSQNYGLYNGAWSRFLVGQEKKTEHDVSSSCGSSDNKESMLVPSCGGERMHRPELEERTGYLEMDDLLEIDDLGLLIGKNGDFKNWCCEEFQHPWNWF
Sequence Length
307
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,234 Da
NCBI Official Full Name
Integrase-type DNA-binding superfamily protein
NCBI Official Symbol
AT5G18450
NCBI Official Synonym Symbols
F20L16.170; F20L16_170
NCBI Protein Information
Integrase-type DNA-binding superfamily protein
UniProt Protein Name
Dehydration-responsive element-binding protein 2G
Protein Family
UniProt Gene Name
DREB2G
UniProt Synonym Gene Names
ERF050; Protein DREB2G
NCBI Description
encodes a member of the DREB subfamily A-2 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are eight members in this subfamily including DREB2A AND DREB2B that are involved in response to drought.
Uniprot Description
Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.
Similar Products
Product Notes
The DREB2G dreb2g (Catalog #AAA1090715) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-307, Full length protein. The amino acid sequence is listed below: MEEEQPPAKK RNMGRSRKGC MKGKGGPENA TCTFRGVRQR TWGKWVAEIR EPNRGTRLWL GTFNTSVEAA MAYDEAAKKL YGHEAKLNLV HPQQQQQVVV NRNLSFSGHG SGSWAYNKKL DMVHGLDLGL GQASCSRGSC SERSSFLQED DDHSHNRCSS SSGSNLCWLL PKQSDSQDQE TVNATTSYGG EGGGGSTLTF STNLKPKNLM SQNYGLYNGA WSRFLVGQEK KTEHDVSSSC GSSDNKESML VPSCGGERMH RPELEERTGY LEMDDLLEID DLGLLIGKNG DFKNWCCEEF QHPWNWF. It is sometimes possible for the material contained within the vial of "Dehydration-responsive element-binding protein 2G (DREB2G), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
