Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

D(3) dopamine receptor (Drd3) Recombinant Protein | Drd3 recombinant protein

Recombinant Mouse D (3) dopamine receptor (Drd3)

Gene Names
Drd3; D3R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
D(3) dopamine receptor (Drd3); Recombinant Mouse D (3) dopamine receptor (Drd3); Drd3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-446aa; Full length protein
Sequence
MAPLSQISSHINSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYMVLRQRRRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKPYPQKCQDPLLSHLQPLSPGQTHGELK RYYSICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNIEFRKAFLKILSC
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Drd3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,168 Da
NCBI Official Full Name
D(3) dopamine receptor
NCBI Official Synonym Full Names
dopamine receptor D3
NCBI Official Symbol
Drd3
NCBI Official Synonym Symbols
D3R
NCBI Protein Information
D(3) dopamine receptor
UniProt Protein Name
D(3) dopamine receptor
Protein Family
UniProt Gene Name
Drd3
UniProt Entry Name
DRD3_MOUSE

Uniprot Description

DRD3: Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Promotes cell proliferation. Genetic variation in DRD3 is associated with essential tremor hereditary type 1 (ETM1). ETM1 is the most common movement disorder. The main feature is postural tremor of the arms. Head, legs, trunk, voice, jaw, and facial muscles also may be involved. The condition can be aggravated by emotions, hunger, fatigue and temperature extremes, and may cause a functional disability or even incapacitation. Inheritance is autosomal dominant. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Cellular Component: apical part of cell; cell projection; endocytic vesicle; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: D1 dopamine receptor binding; dopamine binding; dopamine D1 receptor-like receptor activity; dopamine D2 receptor-like receptor activity; dopamine receptor activity; drug binding; G-protein coupled receptor activity; protein binding; protein domain specific binding; signal transducer activity

Biological Process: acid secretion; arachidonic acid secretion; behavioral response to cocaine; cellular calcium ion homeostasis; circadian regulation of gene expression; dopamine receptor signaling pathway; dopamine receptor, adenylate cyclase activating pathway; dopamine receptor, adenylate cyclase inhibiting pathway; G-protein coupled receptor internalization; G-protein coupled receptor protein signaling pathway; locomotory behavior; musculoskeletal movement, spinal reflex action; negative regulation of adenylate cyclase activity; negative regulation of blood pressure; negative regulation of dopamine receptor signaling pathway; negative regulation of oligodendrocyte differentiation; negative regulation of protein kinase B signaling cascade; negative regulation of protein secretion; negative regulation of sodium:hydrogen antiporter activity; negative regulation of transcription from RNA polymerase II promoter; positive regulation of cell proliferation; positive regulation of cytokinesis; positive regulation of dopamine receptor signaling pathway; positive regulation of mitosis; positive regulation of transcription from RNA polymerase II promoter; prepulse inhibition; regulation of cAMP metabolic process; regulation of circadian sleep/wake cycle, sleep; regulation of dopamine secretion; regulation of lipid metabolic process; regulation of locomotion; regulation of multicellular organism growth; renin-angiotensin regulation of blood volume; response to amphetamine; response to cocaine; response to drug; response to ethanol; response to morphine; signal transduction; synaptic transmission, dopaminergic; visual learning

Research Articles on Drd3

Similar Products

Product Notes

The Drd3 drd3 (Catalog #AAA7013904) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-446aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Drd3 drd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPLSQISSH INSTCGAENS TGVNRARPHA YYALSYCALI LAIIFGNGLV CAAVLRERAL QTTTNYLVVS LAVADLLVAT LVMPWVVYLE VTGGVWNFSR ICCDVFVTLD VMMCTASILN LCAISIDRYT AVVMPVHYQH GTGQSSCRRV ALMITAVWVL AFAVSCPLLF GFNTTGDPSI CSISNPDFVI YSSVVSFYVP FGVTVLVYAR IYMVLRQRRR KRILTRQNSQ CISIRPGFPQ QSSCLRLHPI RQFSIRARFL SDATGQMEHI EDKPYPQKCQ DPLLSHLQPL SPGQTHGELK RYYSICQDTA LRHPNFEGGG GMSQVERTRN SLSPTMAPKL SLEVRKLSNG RLSTSLKLGP LQPRGVPLRE KKATQMVVIV LGAFIVCWLP FFLTHVLNTH CQACHVSPEL YRATTWLGYV NSALNPVIYT TFNIEFRKAF LKILSC. It is sometimes possible for the material contained within the vial of "D(3) dopamine receptor (Drd3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.