Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

D(2) dopamine receptor (Drd2) Recombinant Protein | Drd2 recombinant protein

Recombinant Rat D (2) dopamine receptor (Drd2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
D(2) dopamine receptor (Drd2); Recombinant Rat D (2) dopamine receptor (Drd2); Drd2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-444aa; Full length protein
Sequence
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS AVNPIIYTTFNIEFRKAFMKILHC
Sequence Length
444
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Drd2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,599 Da
NCBI Official Full Name
D(2) dopamine receptor
NCBI Official Synonym Full Names
dopamine receptor D2
NCBI Official Symbol
Drd2
NCBI Protein Information
D(2) dopamine receptor
UniProt Protein Name
D(2) dopamine receptor
Protein Family
UniProt Gene Name
Drd2
UniProt Entry Name
DRD2_RAT

NCBI Description

mediates G-protein coupled signaling; may be involved in movement disorders, schizophrenia, and drug addiction [RGD, Feb 2006]

Uniprot Description

DRD2: Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase. Defects in DRD2 are associated with dystonia type 11 (DYT11); also known as alcohol-responsive dystonia. DYT11 is a myoclonic dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT11 is characterized by involuntary lightning jerks and dystonic movements and postures alleviated by alcohol. Inheritance is autosomal dominant. The age of onset, pattern of body involvement, presence of myoclonus and response to alcohol are all variable. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Cellular Component: acrosome; axon; cytoplasmic vesicle; cytosol; dendrite; dendritic spine; endocytic vesicle; integral to plasma membrane; intracellular; lateral plasma membrane; membrane; nerve terminal; nonmotile primary cilium; perikaryon; plasma membrane; postsynaptic density; synaptic vesicle membrane

Molecular Function: adrenoceptor activity; dopamine binding; dopamine D2 receptor-like receptor activity; dopamine receptor activity; drug binding; G-protein coupled receptor activity; identical protein binding; ionotropic glutamate receptor binding; protein binding; protein heterodimerization activity; protein homodimerization activity; receptor binding

Biological Process: acid secretion; activation of protein kinase activity; adenohypophysis development; adult behavior; adult walking behavior; arachidonic acid secretion; associative learning; auditory behavior; axonogenesis; behavioral response to cocaine; behavioral response to ethanol; branching morphogenesis of a nerve; cellular potassium ion homeostasis; cerebral cortex GABAergic interneuron migration; circadian regulation of gene expression; dopamine metabolic process; dopamine receptor signaling pathway; dopamine receptor, adenylate cyclase inhibiting pathway; dopamine receptor, phospholipase C activating pathway; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); feeding behavior; forebrain development; G-protein coupled receptor internalization; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cAMP nucleotide second messenger; grooming behavior; locomotory behavior; long-term memory; negative regulation of adenylate cyclase activity; negative regulation of blood pressure; negative regulation of cell migration; negative regulation of cell proliferation; negative regulation of circadian sleep/wake cycle, sleep; negative regulation of dopamine receptor signaling pathway; negative regulation of dopamine secretion; negative regulation of innate immune response; negative regulation of insulin secretion; negative regulation of protein kinase B signaling cascade; negative regulation of protein secretion; negative regulation of synaptic transmission, glutamatergic; nerve-nerve synaptic transmission; orbitofrontal cortex development; peristalsis; phosphatidylinositol metabolic process; pigmentation; positive regulation of cytokinesis; positive regulation of dopamine uptake; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of growth hormone secretion; positive regulation of mitosis; positive regulation of multicellular organism growth; positive regulation of neuroblast proliferation; positive regulation of receptor internalization; positive regulation of transcription from RNA polymerase II promoter; prepulse inhibition; protein localization; reduction of cytosolic calcium ion concentration; regulation of cAMP metabolic process; regulation of dopamine secretion; regulation of dopamine uptake; regulation of heart rate; regulation of long-term neuronal synaptic plasticity; regulation of MAPKKK cascade; regulation of phosphoprotein phosphatase activity; regulation of potassium ion transport; regulation of sodium ion transport; regulation of synapse structural plasticity; regulation of synaptic transmission; regulation of synaptic transmission, GABAergic; regulation of systemic arterial blood pressure by neurological process; release of sequestered calcium ion into cytosol; response to amphetamine; response to axon injury; response to cocaine; response to drug; response to ethanol; response to hypoxia; response to inactivity; response to iron ion; response to light stimulus; response to morphine; response to nicotine; response to toxin; sensory perception of smell; startle response; striatum development; synaptic transmission, dopaminergic; synaptogenesis; thermoregulation; visual learning; Wnt receptor signaling pathway

Research Articles on Drd2

Similar Products

Product Notes

The Drd2 drd2 (Catalog #AAA7013899) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-444aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Drd2 drd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDPLNLSWYD DDLERQNWSR PFNGSEGKAD RPHYNYYAML LTLLIFIIVF GNVLVCMAVS REKALQTTTN YLIVSLAVAD LLVATLVMPW VVYLEVVGEW KFSRIHCDIF VTLDVMMCTA SILNLCAISI DRYTAVAMPM LYNTRYSSKR RVTVMIAIVW VLSFTISCPL LFGLNNTDQN ECIIANPAFV VYSSIVSFYV PFIVTLLVYI KIYIVLRKRR KRVNTKRSSR AFRANLKTPL KGNCTHPEDM KLCTVIMKSN GSFPVNRRRM DAARRAQELE MEMLSSTSPP ERTRYSPIPP SHHQLTLPDP SHHGLHSNPD SPAKPEKNGH AKIVNPRIAK FFEIQTMPNG KTRTSLKTMS RRKLSQQKEK KATQMLAIVL GVFIICWLPF FITHILNIHC DCNIPPVLYS AFTWLGYVNS AVNPIIYTTF NIEFRKAFMK ILHC. It is sometimes possible for the material contained within the vial of "D(2) dopamine receptor (Drd2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.