Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

D (2) dopamine receptor A Recombinant Protein | drd2-a recombinant protein

Recombinant Xenopus laevis D (2) dopamine receptor A

Gene Names
drd2-a; d2r; d2dr; drd2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
D (2) dopamine receptor A; Recombinant Xenopus laevis D (2) dopamine receptor A; Recombinant D (2) dopamine receptor A; D(2) dopamine receptor A; D2R-A; D2R 1; drd2-a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-442
Sequence
MDPQNLSMYNDDINNGTNGTAVDQKPHYNYYAMLLTLLVFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWAVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTGSKVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSRGVAVDAHKDKCTHPEDVKLCSVFVKSNGSFPADKKKVILVQEAGKHPEDMEMEMMSSTSPPEKTKHKSASPDHNQLAVPATSNQCKNASLTSPVESPYKAEKNGHPKDSTKPAKVFEIQSMPNGKTRTSIKTMSKKKLSQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHCNCNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC
Sequence Length
442
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,738 Da
NCBI Official Full Name
D(2) dopamine receptor A
NCBI Official Synonym Full Names
dopamine receptor D2
NCBI Official Symbol
drd2-a
NCBI Official Synonym Symbols
d2r; d2dr; drd2
NCBI Protein Information
D(2) dopamine receptor A; D(2) dopamine receptor A; D2R 1; D2R-A
UniProt Protein Name
D(2) dopamine receptor A
Protein Family
UniProt Gene Name
drd2-a
UniProt Synonym Gene Names
D2R-A
UniProt Entry Name
DRD2A_XENLA

Uniprot Description

Function: This is one of the five types (D1 to D5) of receptors for dopamine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. In Xenopus D2R is involved in the regulation of the melanotrope cells of the intermediate pituitary during background adaptation of the animal.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Tissue specificity: Brain; pituitary.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Similar Products

Product Notes

The drd2-a drd2-a (Catalog #AAA1019874) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-442. The amino acid sequence is listed below: MDPQNLSMYN DDINNGTNGT AVDQKPHYNY YAMLLTLLVF VIVFGNVLVC IAVSREKALQ TTTNYLIVSL AVADLLVATL VMPWAVYMEV VGEWRFSRIH CDIFVTLDVM MCTASILNLC AISIDRYTAV AMPMLYNTRY SSKRRVTVMI SVVWVLSFAI SCPLLFGLNN TGSKVCIIDN PAFVIYSSIV SFYVPFIVTL LVYVQIYIVL RKRRKRVNTK RNSRGVAVDA HKDKCTHPED VKLCSVFVKS NGSFPADKKK VILVQEAGKH PEDMEMEMMS STSPPEKTKH KSASPDHNQL AVPATSNQCK NASLTSPVES PYKAEKNGHP KDSTKPAKVF EIQSMPNGKT RTSIKTMSKK KLSQHKEKKA TQMLAIVLGV FIICWLPFFI IHILNMHCNC NIPQALYSAF TWLGYVNSAV NPIIYTTFNV EFRKAFIKIL HC. It is sometimes possible for the material contained within the vial of "D (2) dopamine receptor A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.