Dedicator of cytokinesis protein 1 (Dock1) Recombinant Protein | Dock1 recombinant protein
Recombinant Mouse Dedicator of cytokinesis protein 1 (Dock1) , partial
Gene Names
Dock1; AI854900; b2b3190Clo; 9130006G06Rik; D630004B07Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dedicator of cytokinesis protein 1 (Dock1); Recombinant Mouse Dedicator of cytokinesis protein 1 (Dock1); partial; Dock1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
425-609; DHR-1 domain
Sequence
RNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETLKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKGELEEKGHSATGKGMQSLGSCTISKDSFQISTLVC
Sequence Length
609
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dock1 recombinant protein
This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
182,628 Da
NCBI Official Full Name
dedicator of cytokinesis protein 1
NCBI Official Synonym Full Names
dedicator of cytokinesis 1
NCBI Official Symbol
Dock1
NCBI Official Synonym Symbols
AI854900; b2b3190Clo; 9130006G06Rik; D630004B07Rik
NCBI Protein Information
dedicator of cytokinesis protein 1
UniProt Protein Name
Dedicator of cytokinesis protein 1
Protein Family
UniProt Gene Name
Dock1
UniProt Synonym Gene Names
DOCK180
Uniprot Description
Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Along with DOCK1, mediates CRK/CRKL regulation of epithelial and endothelial cell spreading and migration on type IV collagen. Functions as a guanine nucleotide exchange factor (GEF), which activates Rac Rho small GTPases by exchanging bound GDP for free GTP. Its GEF activity may be enhanced by ELMO1.
Research Articles on Dock1
Similar Products
Product Notes
The Dock1 dock1 (Catalog #AAA1302498) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 425-609; DHR-1 domain. The amino acid sequence is listed below: RNDIYVTLVQ GDFDKGSKTT AKNVEVTVSV YDEDGKRLEH VIFPGAGDEA ISEYKSVIYY QVKQPRWFET LKVAIPIEDV NRSHLRFTFR HRSSQDSKDK SEKIFALAFV KLMRYDGTTL RDGEHDLIVY KAEAKKLEDA ATYLSLPSTK GELEEKGHSA TGKGMQSLGS CTISKDSFQI STLVC . It is sometimes possible for the material contained within the vial of "Dedicator of cytokinesis protein 1 (Dock1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
