DNMT1 recombinant protein

Recombinant Human DNMT1 Protein

Cat. Num. AAA286170

• Gene Names: DNMT1; AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI
• Reactivity: Viral
• Purity: > 85 % as determined by SDS-PAGE.
• Synonyms: DNMT1; Recombinant Human DNMT1 Protein; CXXC9; DNMT; MCMT; Cytosine-5 DNA Methyltransferase 1; CXXC-type zinc finger protein 9; DNA methyltransferase HsaI.; DNMT1 recombinant protein

• Host: E. coli AA 1288-1632 (P26358).
• Reactivity: Viral
• Purity/Purification: > 85 % as determined by SDS-PAGE.
• Form/Format: PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 5% trehalose, pH 7.0) added with 300 mM Imidazole and 15% glycerol.
• Concentration: 0.4 mg/mL (varies by lot)
• Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD

• Source: Human
• Residues: with 6* His-tag.

SDS-PAGE (SDS)

Related Product Information for DNMT1 recombinant protein

DNA (cytosine-5)-methyltransferases (DNMTs), such as DNMT1, maintain patterns of methylated cytosine residues in the mammalian genome. Genomic methylation patterns are reshaped during gametogenesis and early development and undergo programmed alterations during cellular differentiation. Methylation patterns are responsible for the repression of parasitic sequence elements and the expression status of genes subject to genomic imprinting and X inactivation. Faithful maintenance of methylation patterns is required for normal mammalian development, and aberrant methylation patterns are associated with certain human tumors and developmental abnormalities. A DNMT1 enzyme is thought to be responsible for most of the maintenance as well as the de novo methylation activities occurring in the somatic cells of vertebrates.

NCBI and Uniprot Product Information

• NCBI GI #: 195927037
• NCBI GeneID: 1786
• NCBI Accession #: NP_001124295.1
• NCBI GenBank Nucleotide #: NM_001130823.2
• UniProt Accession #: P26358; Q9UHG5; Q9ULA2; Q9UMZ6; A0AV63; B7ZLW6
• Molecular Weight: Predicted MW: 44 kDa; Observed MW: 44 kDa
• NCBI Official Full Name: DNA (cytosine-5)-methyltransferase 1 isoform a
• NCBI Official Synonym Full Names: DNA methyltransferase 1
• NCBI Official Symbol: DNMT1
• NCBI Official Synonym Symbols: AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI
• NCBI Protein Information: DNA (cytosine-5)-methyltransferase 1
• UniProt Protein Name: DNA (cytosine-5)-methyltransferase 1
• UniProt Gene Name: DNMT1
• UniProt Synonym Gene Names: AIM; CXXC9; DNMT; Dnmt1; DNA MTase HsaI; M.HsaI
• UniProt Entry Name: DNMT1_HUMAN

NCBI Description

This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

DNMT1: an ubiquitous DNA methyltransferase that methylates CpG residues. Preferentially methylates hemimethylated DNA. It is responsible for maintaining methylation patterns established in development, and may play an active role in DNA damage repair. Mediates transcriptional repression by direct binding to HDAC2. Its abundance is reduced to non detectable levels at the G0 phase of the cell cycle and is dramatically induced upon entrance into the S-phase of the cell cycle. Interacts with HDAC1 and with PCNA. Forms a complex with DMAP1 and HDAC2, with direct interaction. Forms also a stable complex with E2F1, BB1 and HDAC1. Binds MBD2 and MBD3. Three isoforms of the human protein produced by alternative splicing have been described.

Protein type: Amino Acid Metabolism - cysteine and methionine; Cell development/differentiation; EC 2.1.1.37; Methyltransferase; Methyltransferase, DNA; Transcription regulation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: DNA (cytosine-5-)-methyltransferase activity; DNA binding; DNA-methyltransferase activity; protein binding

Biological Process: DNA methylation; maintenance of DNA methylation; negative regulation of gene expression, epigenetic; negative regulation of histone H3-K9 methylation; positive regulation of histone H3-K4 methylation; Ras protein signal transduction

Disease: Cerebellar Ataxia, Deafness, And Narcolepsy, Autosomal Dominant; Neuropathy, Hereditary Sensory, Type Ie