Deoxyribonuclease-1 (DNASE1) Recombinant Protein | DNASE1 recombinant protein
Recombinant Dog Deoxyribonuclease-1 (DNASE1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Deoxyribonuclease-1 (DNASE1); Recombinant Dog Deoxyribonuclease-1 (DNASE1); DNASE1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-284, Full length protein
Sequence
LRMAAFNIRTFGETKMSNATLSKYIVQILSRYDVAVVQEVRDSHLTAVGKLLDTLNQDDPNAYHYVVSEPLGRSSYKERYLFLFRPDRVSVLDSYQYDDGCEPCGNDTFSREPAIVRFHSPLTEVKEFAVVPLHAAPLDAVAEIDALYDVYLDVQHKWDLEDIVLMGDFNAGCSYVAASQWSSIRLRTNPAFQWLIPDTADTTSTSTHCAYDRIVVAGSQLQHAVVPESAAPFNFQVAYGLSSQLAQAISDHYPVEVTLKRA
Sequence Length
262
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DNASE1 recombinant protein
This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized, DNASE1*1 through DNASE1*6, and the sequence of DNASE1*2 represented in this record. Mutations in this gene have been associated with systemic lupus erythematosus (SLE), an autoimmune disease. A recombinant form of this protein is used to treat the one of the symptoms of cystic fibrosis by hydrolyzing the extracellular DNA in sputum and reducing its viscosity. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,485 Da
NCBI Official Full Name
deoxyribonuclease-1
NCBI Official Synonym Full Names
deoxyribonuclease 1
NCBI Official Symbol
DNASE1
NCBI Protein Information
deoxyribonuclease-1
UniProt Protein Name
Deoxyribonuclease-1
Protein Family
UniProt Gene Name
DNASE1
UniProt Synonym Gene Names
DNase I
Uniprot Description
Serum endocuclease secreted into body fluids by a wide variety of exocrine and endocrine organs (PubMed:14688237). Expressed by non-hematopoietic tissues and preferentially cleaves protein-free DNA (). Among other functions, seems to be involved in cell death by apoptosis (PubMed:14688237). Binds specifically to G-actin and blocks actin polymerization (PubMed:14688237). Together with DNASE1L3, plays a key role in degrading neutrophil extracellular traps (NETs) (). NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation (). Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation ().
Research Articles on DNASE1
Similar Products
Product Notes
The DNASE1 dnase1 (Catalog #AAA1361535) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-284, Full length protein. The amino acid sequence is listed below: LRMAAFNIRT FGETKMSNAT LSKYIVQILS RYDVAVVQEV RDSHLTAVGK LLDTLNQDDP NAYHYVVSEP LGRSSYKERY LFLFRPDRVS VLDSYQYDDG CEPCGNDTFS REPAIVRFHS PLTEVKEFAV VPLHAAPLDA VAEIDALYDV YLDVQHKWDL EDIVLMGDFN AGCSYVAASQ WSSIRLRTNP AFQWLIPDTA DTTSTSTHCA YDRIVVAGSQ LQHAVVPESA APFNFQVAYG LSSQLAQAIS DHYPVEVTLK RA. It is sometimes possible for the material contained within the vial of "Deoxyribonuclease-1 (DNASE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
