Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DnaJ homolog subfamily B member 1 (Dnajb1) Recombinant Protein | Dnajb1 recombinant protein

Recombinant Mouse DnaJ homolog subfamily B member 1 (Dnajb1)

Gene Names
Dnajb1; DjB1; Hdj1; HSPF1; Hsp40; 0610007I11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily B member 1 (Dnajb1); Recombinant Mouse DnaJ homolog subfamily B member 1 (Dnajb1); Dnajb1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-340, full length protein
Sequence
GKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLPI
Sequence Length
339
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,167 Da
NCBI Official Full Name
dnaJ homolog subfamily B member 1 isoform 1
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member B1
NCBI Official Symbol
Dnajb1
NCBI Official Synonym Symbols
DjB1; Hdj1; HSPF1; Hsp40; 0610007I11Rik
NCBI Protein Information
dnaJ homolog subfamily B member 1
UniProt Protein Name
DnaJ homolog subfamily B member 1
Protein Family
UniProt Gene Name
Dnajb1
UniProt Synonym Gene Names
Hsp40; Hspf1; HSP40; Heat shock protein 40

NCBI Description

This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. The encoded protein may also inhibit apoptosis. Peritoneal macrophages derived from homozygous knockout mice for this gene exhibit impaired heat tolerance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro).

Research Articles on Dnajb1

Similar Products

Product Notes

The Dnajb1 dnajb1 (Catalog #AAA1319188) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-340, full length protein. The amino acid sequence is listed below: GKDYYQTLGL ARGASDDEIK RAYRRQALRY HPDKNKEPGA EEKFKEIAEA YDVLSDPRKR EIFDRYGEEG LKGGSPSGGS SGGANGTSFS YTFHGDPHAM FAEFFGGRNP FDTFFGQRNG EEGMDIDDTF SSFPMGMGGF TNMNFGRSRP SQEPTRKKQD PPVTHDLRVS LEEIYSGCTK KMKISHKRLN PDGKSIRNED KILTIEVKRG WKEGTKITFP KEGDQTSNNI PADIVFVLKD KPHNIFKRDG SDVIYPARIS LREALCGCTV NVPTLDGRTI PVVFKDVIRP GMRRKVPGEG LPLPKTPEKR GDLVIEFEVI FPERIPVSSR TILEQVLPI. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily B member 1 (Dnajb1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.