Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DnaJ homolog subfamily A member 3, mitochondrial (DNAJA3) Recombinant Protein | DNAJA3 recombinant protein

Recombinant Human DnaJ homolog subfamily A member 3, mitochondrial (DNAJA3) , partial

Gene Names
DNAJA3; TID1; HCA57; hTID-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily A member 3; mitochondrial (DNAJA3); Recombinant Human DnaJ homolog subfamily A member 3; partial; DNAJA3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
89-159aa; Partial
Sequence
LAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,082 Da
NCBI Official Full Name
dnaJ homolog subfamily A member 3, mitochondrial isoform 2
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member A3
NCBI Official Symbol
DNAJA3
NCBI Official Synonym Symbols
TID1; HCA57; hTID-1
NCBI Protein Information
dnaJ homolog subfamily A member 3, mitochondrial
UniProt Protein Name
DnaJ homolog subfamily A member 3, mitochondrial
Protein Family
UniProt Gene Name
DNAJA3
UniProt Synonym Gene Names
HCA57; TID1; hTid-1

NCBI Description

This gene encodes a member of the DNAJ/Hsp40 protein family. DNAJ/Hsp40 proteins stimulate the ATPase activity of Hsp70 chaperones and play critical roles in protein folding, degradation, and multimeric complex assembly. The encoded protein is localized to mitochondria and mediates several cellular processes including proliferation, survival and apoptotic signal transduction. The encoded protein also plays a critical role in tumor suppression through interactions with oncogenic proteins including ErbB2 and the p53 tumor suppressor protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

Modulates apoptotic signal transduction or effector structures within the mitochondrial matrix. Affect cytochrome C release from the mitochondria and caspase 3 activation, but not caspase 8 activation. Isoform 1 increases apoptosis triggered by both TNF and the DNA-damaging agent mytomycin C; in sharp contrast, isoform 2 suppresses apoptosis. Can modulate IFN-gamma-mediated transcriptional activity. Isoform 2 may play a role in neuromuscular junction development as an effector of the MUSK signaling pathway.

Research Articles on DNAJA3

Similar Products

Product Notes

The DNAJA3 dnaja3 (Catalog #AAA1324046) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 89-159aa; Partial. The amino acid sequence is listed below: LAKEDYYQIL GVPRNASQKE IKKAYYQLAK KYHPDTNKDD PKAKEKFSQL AEAYEVLSDE VKRKQYDAYG S. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily A member 3, mitochondrial (DNAJA3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.