Putative movement protein (DNA-M) Recombinant Protein | DNA-M recombinant protein

Recombinant Faba bean necrotic yellows virus Putative movement protein (DNA-M)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Putative movement protein (DNA-M); Recombinant Faba bean necrotic yellows virus Putative movement protein (DNA-M); Recombinant Putative movement protein (DNA-M); Putative movement protein; MP; DNA-M recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-114
• Sequence: MADTGYYAGYQDDVDVDEHKRHQALYLIGIILLVTVCLIVLWVCIMLACYVPGFLKKTLEAWLNSSSLMKRRVASTLTRTPFEATGPERERNWDARRQSTTVNPASQPNTGSVF
• Sequence Length: 114

• Species: Faba bean necrotic yellows virus (isolate SV292-88) (FBNYV)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 81921313
• UniProt Accession #: O39830
• Molecular Weight: 12,882 Da
• NCBI Official Full Name: Putative movement protein
• UniProt Protein Name: Putative movement protein
• Protein Family: Movement and RNA silencing protein
• UniProt Gene Name: DNA-M
• UniProt Synonym Gene Names: C4; MP
• UniProt Entry Name: MVP_FBNY2

Uniprot Description

Function: May transport viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier

By similarity.

Subcellular location: Host cell membrane; Single-pass membrane protein

Potential. Note: The hydrophobic region is responsible for the localization of the protein to the cell periphery

By similarity.

Sequence similarities: Belongs to the nanovirus movement protein family.